KEGG   Pongo abelii (Sumatran orangutan): 100172608
Entry
100172608         CDS       T01416                                 

Gene name
GUCY1A1
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-3
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon01100  Metabolic pathways
pon04022  cGMP-PKG signaling pathway
pon04270  Vascular smooth muscle contraction
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04730  Long-term depression
pon04921  Oxytocin signaling pathway
pon04924  Renin secretion
pon04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100172608 (GUCY1A1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100172608 (GUCY1A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100172608 (GUCY1A1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100172608 (GUCY1A1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100172608 (GUCY1A1)
   04924 Renin secretion
    100172608 (GUCY1A1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100172608 (GUCY1A1)
  09154 Digestive system
   04970 Salivary secretion
    100172608 (GUCY1A1)
  09156 Nervous system
   04730 Long-term depression
    100172608 (GUCY1A1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100172608 (GUCY1A1)
Enzymes [BR:pon01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100172608 (GUCY1A1)
SSDB
Motif
Pfam: HNOBA HNOB
Other DBs
NCBI-GeneID: 100172608
NCBI-ProteinID: NP_001125687
UniProt: Q5RAN8
LinkDB
Position
4
AA seq 416 aa
MFCTKLKDLKITGECPFSLLAPGQVPNESSEEAAGSSESCKATVPICQDIPEKNIQESLP
QRKTSRSRVYLHTLAESICKLIFPEFERLNVALQRTLAKHKIKESRKSLEREDFEKIIAE
QAVAAGVPVEVIKESLGEELFKICYEEDENILGVVGGTLKDFLNSFSTLLKQSSHCQEAG
KRGRLEDASILCLDKEDDFLHVYYVLPKRTTSLILPGIIKAAAHVLYETEVEVSLMPPCF
HNDCSEFVNQPYLLYSVHVKSTKPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQ
FGNGIRRLMNRRDFQGRPNFEEYFEILTPKINQTFSGIMTMLNMQFVVRVRRWDNSVKKS
SRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIG
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgttctgcacgaagctcaaggatctcaagatcacaggagaatgtcctttctccttactg
gcaccaggtcaagttcctaacgagtcttcagaggaggcagcaggaagctcagagagctgc
aaagcaaccgtgcccatctgtcaagacattcctgagaagaacatacaagaaagtcttcct
caaagaaaaacgagtcggagccgagtctatcttcacactttggcagagagtatttgcaaa
ctgattttcccagagtttgaacggctgaacgttgcacttcagagaacattggcaaagcac
aaaataaaagaaagcaggaaatctttggaaagagaagactttgaaaaaataattgcagaa
caagcagttgcagcaggagttccagtggaggttatcaaagaatctcttggtgaagagctt
tttaaaatatgttatgaggaagatgaaaacatccttggggtggttggaggcacccttaaa
gattttttaaacagcttcagtacccttctgaaacagagcagccattgccaagaagcaggc
aaaaggggcaggcttgaggacgcctccattctatgcctggataaggaggatgattttcta
catgtttactacgtcctccctaagagaaccacctccctgattcttcccggcatcataaag
gcagctgctcatgtattatatgaaacggaagtggaagtgtcgttaatgcctccctgcttc
cataatgattgcagcgagtttgtgaatcagccctatttgttgtactccgttcacgtgaaa
agcaccaagccatccctgtcccccagcaaaccccagtcctcgctggtgattcccacatca
ctcttctgcaagacatttccattccatttcatgtttgacaaagatatgacaattctgcaa
tttggcaatggcatcagaaggctgatgaacaggagagactttcaaggaaggccgaatttt
gaagaatactttgaaattctgactccaaaaatcaaccagacatttagcgggatcatgact
atgttgaatatgcagtttgttgtacgagtgaggagatgggacaactctgtgaagaaatct
tcaagggttatggacctcaaaggccaaatgatctacattgttgaatccagtgcaatcttg
tttttggggtcgccctgtgtggacagattagaagattttacaggacgagggctctacctc
tcagacatcccaattcacaatgcattgagggatgtggtcttaataggctaa

KEGG   Pongo abelii (Sumatran orangutan): 100434873
Entry
100434873         CDS       T01416                                 

Gene name
GUCY1B1
Definition
(RefSeq) guanylate cyclase soluble subunit beta-1 isoform X1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon01100  Metabolic pathways
pon04022  cGMP-PKG signaling pathway
pon04270  Vascular smooth muscle contraction
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04730  Long-term depression
pon04921  Oxytocin signaling pathway
pon04924  Renin secretion
pon04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100434873 (GUCY1B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100434873 (GUCY1B1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100434873 (GUCY1B1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100434873 (GUCY1B1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100434873 (GUCY1B1)
   04924 Renin secretion
    100434873 (GUCY1B1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100434873 (GUCY1B1)
  09154 Digestive system
   04970 Salivary secretion
    100434873 (GUCY1B1)
  09156 Nervous system
   04730 Long-term depression
    100434873 (GUCY1B1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100434873 (GUCY1B1)
Enzymes [BR:pon01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100434873 (GUCY1B1)
SSDB
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Other DBs
NCBI-GeneID: 100434873
NCBI-ProteinID: XP_002815288
Ensembl: ENSPPYG00000015147
LinkDB
Position
4
AA seq 619 aa
MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLN
LNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSF
RCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFL
IEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVL
PQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTE
ISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFR
EEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNV
TILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYM
TVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRY
CLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQ
VWFLSRKNTGTEETKQDDD
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgtacggatttgtgaatcacgccctggagctgctggtgatccgcaattacggccccgag
gtgtgggaagacatcaaaaaagaggcacagttagatgaagaaggacagtttcttgtcaga
ataatatatgatgactccaaaacttatgatttggttgctgctgcaagcaaagtcctcaat
ctcaatgctggagaaatcctccaaatgtttgggaagatgtttttcgtcttttgccaagaa
tctggttatgatacaatcttgcgtgtcctgggctctaatgtcagagaatttctacagaac
cttgatgctctgcacgaccaccttgctaccatctacccaggaatgcgtgcaccttccttt
aggtgcactgatgcagaaaagggcaaaggacttattttgcactactactcagagagagaa
ggacttcaggatattgtcattggaatcatcaaaacagtggctcaacaaatccatggcact
gaaatagacatgaaggttattcagcaaagaaatgaagaatgtgatcatactcaattttta
attgaagaaaaagagtcaaaagaagaggatttttatgaagatcttgacagatttgaagaa
aatggtacccaggaatcacgcatcagtccatatacattctgcaaagcttttccttttcat
ataatatttgaccgggatctagtggtcactcagtgtggcaatgctatatacagagttctc
ccccagctccagcctgggaattgcagccttctgtctgtcttctcgttggttcgtcctcat
attgatattagtttccatgggatcctttcgcacatcaataccgtttttgtattgagaagc
aaggaaggattgttggatgtggagaaattagaatgtgaggatgaactgactgggactgag
atcagctgcttacgtctcaagggtcaaatgatctacttacctgaagcagatagcatactt
tttctgtgttcaccaagtgtcatgaacctggacgatttgacaaggagagggctgtatcta
agtgacatccctctgcatgatgccacgcgtgatctcgttcttttgggagaacaatttaga
gaggaatacaaactcacccaagaactggaaatcctcactgacaggctacagctcacgtta
agagccctggaagatgaaaagaaaaagacagacacattgctgtattctgtccttcctcca
tctgttgccaatgagctgcggcacaagcgtccagtgcctgccaaaagatatgacaatgtg
actatcctcttcagtggcattgtgggcttcaatgctttctgtagcaagcatgcatctgga
gaaggggccatgaagatcgtaaaccttctcaacgacctctacaccagatttgacacactg
actgattcccggaaaaacccatttgtttataaggtggagactgttggtgacaagtatatg
acagtgagtggtttaccagagccatgcattcaccatgcacgatccatctgccacctggcc
ttggacatgatggaaattgctggccaggttcaagtagatggtgaatctgttcagataaca
atagggatacacactggagaggtagttacaggtgtcataggacagcggatgcctcgatac
tgtctttttggaaatactgtcaacctcacaagccgaacagaaaccacaggagaaaaggga
aaaataaatgtgtctgaatatacatacagatgtcttatgtctccagaaaattcagatcca
caattccacttggagcacagaggcccagtgtccatgaagggcaaaaaagaaccaatgcaa
gtttggtttctatccagaaaaaatacaggaacagaggaaacaaagcaggatgatgactga

KEGG   Pongo abelii (Sumatran orangutan): 100445008
Entry
100445008         CDS       T01416                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-2
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon01100  Metabolic pathways
pon04022  cGMP-PKG signaling pathway
pon04270  Vascular smooth muscle contraction
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04730  Long-term depression
pon04921  Oxytocin signaling pathway
pon04924  Renin secretion
pon04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100445008
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100445008
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100445008
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100445008
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100445008
   04924 Renin secretion
    100445008
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100445008
  09154 Digestive system
   04970 Salivary secretion
    100445008
  09156 Nervous system
   04730 Long-term depression
    100445008
  09159 Environmental adaptation
   04713 Circadian entrainment
    100445008
Enzymes [BR:pon01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100445008
SSDB
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Other DBs
NCBI-GeneID: 100445008
NCBI-ProteinID: XP_024086551
LinkDB
Position
13
AA seq 793 aa
MTYTMYDDIITIKLIQEACNILGVSMEAILKLFGEYFFQFCKMSGYDRMLRTLGGNLMEF
IENLEALHSYLALSYQEMNAPSFRVERGADGKMFFHYYSGRGGLCHIVPGIIEAVAKDFF
DINVTMDILDMNEEVERTGKKEHVVFLIVQKARRKVRKTKPKRLQDSQGIERDQEALLAA
FLRMKEKYLNVSSYPVKKFHWDVVRSIVMFGKGHLMNTFEPIYPERLWIEEKTFCYAFPF
HIVFDESLRVKQAGVNSQKYVPGLQTQKIQLDEYFSIIHPQVTFNIFSILKFINSQFVLK
TRREMIPVAWQSQTTLKLRVQMIWMECMRCMVYLCSPKFRSLQELEELNMHLSDIAPHDT
TRDLILLNQQRLAEIELSNQLERKKEELRVLSKHLAIEKKKTETLLCAMLPKHVANQLRE
GKKVAAGECKSCTILFSDVVTFTNICTACEPIQIVNMLNSMYSKFDRLTSVHAVYKVETI
GDAYMVVGGVPVPFGSHAQRVANFALGMRISAKEVINPVTGEHIQIRVGIHTGPVLAGVV
GDKMPWYCLFGDTVNTASRMESLGLPNKVHLSPTAYRALKNQGFEIIERGEIEVKGKGKM
TTYFLIQNLNATEDEIMGRSKTPLDHKGSTQIASLPTTKLQGSVQPSCPDSCILFPLPFP
GSLGFPAVSLSHKALGEEASAQGNQDRRTVAIMSYADSQQLIPDRDAADADGREKGKKKM
NLKEIGVEMEEMEDPVKTQVRKMKNAPDEIIPVGSAGPDGDSMETADRRQPSVPTKTHHL
ANDTVPSGFCVLL
NT seq 2382 nt   +upstreamnt  +downstreamnt
atgacctacacaatgtatgatgacatcatcaccattaagctcatccaagaggcctgcaac
attctgggtgtctccatggaagccatcctgaaactctttggagaatacttctttcaattc
tgtaagatgtctggctatgacaggatgctacggacactgggaggaaatctcatggagttt
attgaaaacctagaagccctccacagttacctggcactctcttatcaggagatgaatgca
ccatcgtttcgtgtggagagaggagcagatgggaaaatgtttttccattactactcgggt
agaggtggtctgtgccacattgtaccaggtatcattgaggctgtggccaaagacttcttt
gacattaatgtaaccatggacattcttgacatgaatgaagaagtggagaggacagggaag
aaggagcatgttgtgtttctgattgtacagaaggctcgcaggaaggtgagaaagacaaag
ccaaaaagattacaagacagtcagggcatcgagagagaccaagaggccctcctggcagct
ttcctcaggatgaaggagaagtatttgaatgtctcttcttatcctgtgaaaaaattccac
tgggatgttgtgagaagcatagtcatgtttggaaaagggcatctcatgaacacctttgag
ccaatttatcctgagagactctggattgaagagaagacattctgctatgcttttcctttc
cacattgtatttgatgaatcactacgggtgaagcaagccggagtgaacagtcagaagtac
gtaccaggactccaaacccagaagattcaactggatgagtatttctccatcattcatcct
caagttaccttcaacattttcagcatcctcaaatttatcaacagtcaatttgtcctgaag
acacgaagagaaatgatacctgtagcatggcaaagtcagaccacactcaaacttcgagtc
cagatgatctggatggagtgcatgcggtgcatggtgtacctgtgctctccaaagttccgc
agcctgcaagagctggaagaactcaatatgcatctttctgacatcgccccccacgacacc
accagggatctcatcctcctgaaccagcagcggctggctgagatagagctgtccaaccag
ctggaaaggaagaaggaggagctacgggtcctctccaagcacttggccattgaaaagaag
aaaacagagaccttactttgtgccatgctgcccaaacatgtggccaaccagctgagggag
ggcaaaaaggtggctgcaggagaatgtaaaagctgcacgattcttttcagtgatgtagtg
acatttactaacatctgtactgcctgtgaacctatacaaatagtgaacatgctgaactcc
atgtactccaagtttgacagattaaccagtgtgcacgcggtctataaggtagaaacaata
ggagatgcttatatggtggtaggaggtgtaccagtgccttttggaagccatgctcaaaga
gtggctaattttgccttggggatgagaatttctgcaaaggaagtgataaatcctgttact
ggagaacacatccagatcagagtggggatccatactggaccagtcttagcaggtgttgta
ggagacaagatgccatggtactgcttgtttggtgacactgtgaacacagcttctaggatg
gaaagtcttgggcttcccaacaaagtgcacctcagtcccacagcctacagagccttgaaa
aatcaagggtttgaaatcattgagaggggtgaaatcgaagtgaaaggtaaagggaaaatg
accacatactttttgatccagaacttgaatgccacagaggatgagatcatggggagatct
aaaaccccacttgatcacaaggggtcaacacagatagcgtccctgcccaccaccaagctc
cagggctcagttcaaccatcttgccctgattcttgcatcctgttccctctccctttcccc
ggcagccttggatttcctgctgtgagcctcagccacaaggctttgggggaggaagcaagt
gctcagggaaatcaagacaggagaactgttgccatcatgagctatgccgacagtcagcag
ctgatccccgacagagacgcagcagacgcagacgggagagaaaagggaaagaagaaaatg
aatttaaaggaaataggagtagaaatggaggagatggaagatccagttaagacacaagtg
agaaaaatgaaaaatgctcctgatgaaatcatccctgtggggagtgcagggccagatggg
gactccatggagacagccgaccggcgacagccttcagttccgacaaagacacatcacctt
gcaaatgacactgtgccgtctggtttctgtgttttgttgtaa

KEGG   Pongo abelii (Sumatran orangutan): 100445361
Entry
100445361         CDS       T01416                                 

Gene name
GUCY1A2
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon01100  Metabolic pathways
pon04022  cGMP-PKG signaling pathway
pon04270  Vascular smooth muscle contraction
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04730  Long-term depression
pon04921  Oxytocin signaling pathway
pon04924  Renin secretion
pon04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100445361 (GUCY1A2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100445361 (GUCY1A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100445361 (GUCY1A2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100445361 (GUCY1A2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100445361 (GUCY1A2)
   04924 Renin secretion
    100445361 (GUCY1A2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100445361 (GUCY1A2)
  09154 Digestive system
   04970 Salivary secretion
    100445361 (GUCY1A2)
  09156 Nervous system
   04730 Long-term depression
    100445361 (GUCY1A2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100445361 (GUCY1A2)
Enzymes [BR:pon01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100445361 (GUCY1A2)
SSDB
Motif
Pfam: Guanylate_cyc HNOBA HNOB Rx_N
Other DBs
NCBI-GeneID: 100445361
NCBI-ProteinID: XP_002822475
Ensembl: ENSPPYG00000003832
UniProt: H2NF58
LinkDB
Position
11
AA seq 734 aa
MSRRKISSESFSSLGSDYLETSPEEEGECPLSRLCWNGSRSPPGPLAPRPAAAAAAAAAA
AAPAPAASAAAAAATAGARRVQRRRRVNLDSLGESISRLTAPSPQTIQQTLKRTLQYYEH
QVIGYRDAEKNFHNISNRCFYADHSNKEEIEDVSGILQCTANILGLKFEEIQERFGEEFF
NICFHENERVLRAVGGTLQDFFNGFDALLEHIRTSFGKQATLESPSFLCKELPEGTLMLH
YFHPHHIVGFAMLGMIKAAGKKIYRLDVEVEQVANEKLCSDVSNPGNCSCLTFLIKECEN
TNIMKNLPQGTSQVPADLRISINTFCRAFPFHLMFDPSMSVLQLGEGLRKQLRCDTHKVL
KFEDCFEIVSPKVNATFERVLLRLSTPFVIRTKPEASGSENKDKVMEVKGQMIHVPESNS
ILFLGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLER
THQALEEEKKKTVDLLYSIFPGDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCT
PMQVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHRKSLCHAKPIALMALKMME
LSEEVLTPDGRPIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINV
SPTTYQLLKREESFTFIPRSREELPDNFPKEIPGICYFLEVRTGPKPPKPSLSSSRIKKV
SYNIGTMFLRETSL
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgtctcgaaggaagatttcgtccgagtccttcagctccctgggctctgactacctggag
accagcccggaggaggagggggagtgccccctgtctaggctctgctggaatggcagccgg
agcccgcccgggccgctggcgccccgcccggccgccgctgccgctgccgctgccgctgct
gccgccccggccccggctgcttctgccgccgccgccgccgccactgccggggccaggagg
gtgcaacgccggaggcgggtcaacctggattcgctgggcgagagcatcagccgcctgacg
gcgccctcgcctcagacgatacagcaaactctcaagaggacactgcagtattatgaacat
caagttattggttacagggatgcagaaaagaatttccacaatatctctaacagatgcttc
tatgcagaccactccaacaaagaagaaattgaagatgtctcaggaattcttcagtgtact
gctaatatactcggtttgaagtttgaggaaattcaagaaagatttggtgaagagttcttt
aatatatgctttcatgagaatgagagagtccttcgagctgtaggtggcactttgcaggac
ttttttaatggctttgatgctttgttggaacacattagaacttcttttggaaaacaggcc
actctggagtcaccatctttcctatgcaaagagctccctgaaggtactctcatgctccac
tacttccaccctcaccatattgtggggtttgcaatgttggggatgattaaggctgcagga
aagaagatctatcggctggatgtggaagtggaacaggttgcaaatgagaagctatgctct
gatgtttcaaacccaggcaattgtagctgtcttactttccttatcaaagaatgtgaaaat
actaatatcatgaagaaccttccacagggaacctcccaagttcctgcggacctcagaatt
agcatcaacaccttctgtagagccttcccttttcacttgatgtttgaccccagcatgtca
gtccttcagttgggggaaggtctaaggaagcagcttcgatgtgacactcacaaagtgctc
aagtttgaggactgctttgagattgtatctccaaaggttaatgccacctttgaaagggtc
ctgctgcgactgtctaccccatttgtgattagaaccaagcctgaggcttctggctctgaa
aataaagacaaggtgatggaagtcaaaggacaaatgatccatgttccagaatcaaattcc
attttatttttgggctctccatgtgtggacaagttggatgaactcatgggccgagggcta
catctctcagacatccctatccatgatgccacccgagatgtcattttggttggtgagcag
gcaaaggcccaagatgggttgaagaaaaggatggataaattaaaggccactttagaaaga
actcaccaggccctggaagaagagaaaaagaagacagtggatcttctatattctattttc
cctggtgatgtagcccagcaattgtggcaagggcagcaagtacaggccagaaagtttgat
gatgtcaccatgctcttttcagacattgttggcttcacagccatatgtgcccagtgtact
cccatgcaagtaatcagcatgctgaatgaactgtacaccagatttgaccaccagtgtgga
tttttggatatttataaggtggaaacaataggtgatgcctactgtgttgcagcagggctt
cacagaaaaagcctctgccatgctaaacccattgctctgatggccttgaagatgatggaa
ctttcagaagaagtgctgacacctgatggaagaccgattcagatgaggataggaattcac
tcgggctccgtgctggctggagttgttggggtgcgaatgccacgttattgcctgtttgga
aataatgtcacgctggcaagcaaattcgagtcgggaagtcaccctcggcgcatcaatgtc
agcccaaccacttaccaattattaaaacgagaagaaagtttcacattcattccgcggtct
cgtgaagagcttccagacaactttccaaaggaaattcctgggatctgctatttcctggag
gtaaggactggtccaaagccaccaaagccttctctttcttcgtcgagaataaaaaaggtt
tcctacaacatcggcaccatgttcctccgggagacaagcctctga

DBGET integrated database retrieval system