KEGG   Pongo abelii (Sumatran orangutan): 100172617
Entry
100172617         CDS       T01416                                 

Gene name
PPP1R12A
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12A isoform X1
  KO
K06270  protein phosphatase 1 regulatory subunit 12A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04270  Vascular smooth muscle contraction
pon04510  Focal adhesion
pon04611  Platelet activation
pon04810  Regulation of actin cytoskeleton
pon04921  Oxytocin signaling pathway
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100172617 (PPP1R12A)
   04022 cGMP-PKG signaling pathway
    100172617 (PPP1R12A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100172617 (PPP1R12A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100172617 (PPP1R12A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100172617 (PPP1R12A)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100172617 (PPP1R12A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100172617 (PPP1R12A)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100172617 (PPP1R12A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100172617 (PPP1R12A)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100172617 (PPP1R12A)
SSDB
Motif
Pfam: Ank_2 Ank_4 PRKG1_interact Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 100172617
NCBI-ProteinID: XP_024113172
Ensembl: ENSPPYG00000004796
LinkDB
Position
12
AA seq 1030 aa
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLL
HRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLD
IAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRD
ARQWLNSGHINDVRHAKSGGTALHVAAAKGYTEVLKLLIQAGYDVNIKDYDGWTPLHAAA
HWGKEEACRILVDNLCDMEMVNKVGQTAFDVADEDILGYLEELQKKQNLLHSEKRDKKSP
LIESTANMDNNQSQKTFKNKETLIIEPEKNASRIESLEQEKVDEEEEGKKDESSCSSEED
EEDDSESEAETDKTKPLASVTNANTSSTQAAPVAVTTPTVSSGQATPTSPIKKFPTTATK
ISPKEEERKDESPATWRLGLRKTGSYGALAEITASKEGQKEKDTAGVTRSASSPRLSSSL
DNKEKEKDSKGTRLAYVAPTIPRRLASTSDIEEKENRDSSSLRTSSSYTRRKWEDDLKKN
SSINEGSTYHKSCSFGRRQDDLISSSVPSTTSTPTVTSAAGLQKSLLSSTSTTTKITTGS
SSAGTQSSTSNRLWAEDSTEKEKESVPTAVTIPVAPTVVNAAASTTTLTTTTAGTVSSTT
EVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRSRSTRTR
EQENEEKEKEEKEKQDKEKQEEKKESETSREDEYKQKYSRTYDETYQRYRPVSTSSSTTP
SSSLSTMSSSLYASGQLNRPNSLVGITSAYSRGITKENEREGEKREEEKEGEDKSQPKSI
RERRRPREKRRSTGVSFWTQDSDENEQEQQSDTEEGSNKKETQTDSISRYETSSTSAGDR
YDSLLGRSGSYSYLEERKPYSSRLEKDDSTDFKKLYEQILAENEKLKAQLHDTNMELTDL
KLQLEKATQRQERFADRSLLEMEKRERRALERRISEMEEELKMLPDLKADNQRLKDENGA
LIRVISKLSK
NT seq 3093 nt   +upstreamnt  +downstreamnt
atgaagatggcggacgcgaagcagaagcggaacgagcagctgaagcgctggatcggctcc
gagacggacctcgagcctccggtggtgaagcgccagaagaccaaggtgaagttcgacgat
ggcgccgtcttcctggctgcttgctccagcggcgacacggacgaggtcctcaagctgctg
caccgcggcgccgacatcaattacgccaatgtggacggactcactgccctgcaccaggct
tgcattgatgacaatgttgatatggtgaagtttctggtagaaaatggagcaaatattaat
caacctgataatgaaggctggataccactacatgcagcagcttcctgtggatatcttgat
attgcagagtttttgattggtcaaggagcacatgtaggggctgtcaacagtgaaggagat
acacctttagatattgcggaggaggaggcaatggaagagctacttcaaaatgaagttaat
cggcaaggggttgatatagaagcagctcgaaaggaagaagaacgtatcatgcttagagat
gccaggcagtggctaaatagtggtcatataaatgatgtccggcatgcaaaatctggaggt
acagcacttcacgttgcagctgctaaaggctatacggaagttttaaaacttttaatacag
gcaggctatgacgttaatattaaagactatgatggctggacacctcttcatgctgcagct
cattggggtaaagaagaagcatgtcgaattttagtggacaatctgtgtgatatggagatg
gtcaacaaagtgggccaaacagcctttgatgtagcagatgaagacattttaggatattta
gaagagttgcaaaagaaacaaaatctgctccatagtgaaaaacgggacaagaaatctcca
ctaattgaatcaacagcaaatatggacaataatcagtcacagaagacctttaaaaacaaa
gagacgttgattattgaaccagagaaaaacgcatcccgtattgaatctctggaacaagaa
aaggttgatgaagaagaagaaggaaagaaggatgagtctagctgctctagtgaagaagat
gaggaagatgactcggaatcagaagctgaaacagataagacaaaaccgctggcttctgtg
actaatgccaacacttccagtacacaagcagctcctgtagctgttacaacacctactgtg
tcatcaggtcaagcaacacctacatcacctattaaaaagtttccaaccacagctacaaaa
atttctcccaaagaagaagagagaaaagatgagtctcctgcaacttggaggttaggactt
agaaagacaggcagctatggtgcacttgctgaaatcacagcatctaaagagggtcaaaaa
gaaaaagatactgcaggtgttacacgttcagcttcaagtcccagactttcctcctctttg
gataataaagaaaaggagaaagatagtaaaggaactaggcttgcatatgttgcacctaca
ataccaagacgactagccagtacatctgacattgaagagaaagaaaacagagattcttca
agtttgcgaacaagtagttcatatacaaggagaaaatgggaagatgatcttaaaaaaaat
agctcaattaatgaaggatcaacttatcataaaagttgctcctttggtagaagacaagat
gatttgattagttctagtgttccaagcaccacatcaacaccaacagttacctctgcagct
gggcttcagaaaagcctgctttccagcacaagcactactacaaagattacaacgggttct
tcctcagcaggcacacaaagcagtacctcaaatcgtttgtgggctgaggatagtactgaa
aaagaaaaggaaagtgttcctacggcagtgaccattcctgttgctccaactgttgtaaat
gctgcagcttctaccacaaccctgactacaactactgctggcactgtctcctccacaaca
gaggtcagggagagacgcagatcatacctcactcctgttagggatgaagagtctgaatcc
caaagaaaagcaagatctagacaagcaagacaatctagaagatcaacacagggagtgaca
ttaactgatcttcaagaagctgagaaaacaataggaagaagtcgttctacccgaaccaga
gaacaagaaaatgaagaaaaagaaaaagaggaaaaagaaaaacaagataaagagaaacaa
gaagaaaagaaggagtcagaaacatctagagaagacgaatataaacaaaagtactccaga
acgtatgatgagacttaccagcgttataggccagtatcaacttcaagttcaaccactcca
tcctcttcactttctactatgagcagttcactctatgcttcaggtcaactaaacaggcca
aatagtcttgtaggcataacttctgcttactccagaggaataacaaaagaaaatgaaaga
gagggagaaaaaagagaagaggagaaagaaggagaagataaatcacaacctaaatcaatc
agagaacgacgacgaccaagagagaaaagaagatctacaggagtttcattttggacacaa
gatagtgatgaaaatgaacaagaacaacaatcagacacagaagagggatccaataagaaa
gaaactcagacggattccatttctagatatgaaaccagttctacatcagctggtgatcga
tatgattccttgctgggtcgctctggatcatacagttacttagaagaaagaaaaccttac
agcagcaggctagaaaaggatgactcaactgactttaaaaagctttatgaacaaattcta
gctgaaaatgaaaagctgaaggcacagctacatgatacaaatatggaactaacggatctt
aaattacagttggaaaaggccacacagagacaagaaagatttgctgataggtcactgttg
gaaatggaaaaaagggaacgaagagctctagaaagaagaatatctgaaatggaagaagag
ctcaaaatgttaccagacctaaaagcagacaaccagaggctaaaggatgaaaatggggcc
ttgatcagagttataagcaaactttccaaataa

KEGG   Pongo abelii (Sumatran orangutan): 100173410
Entry
100173410         CDS       T01416                                 

Gene name
PPP1CB
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-beta catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04114  Oocyte meiosis
pon04218  Cellular senescence
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04390  Hippo signaling pathway
pon04510  Focal adhesion
pon04611  Platelet activation
pon04720  Long-term potentiation
pon04728  Dopaminergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04921  Oxytocin signaling pathway
pon04931  Insulin resistance
pon05031  Amphetamine addiction
pon05034  Alcoholism
pon05168  Herpes simplex virus 1 infection
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100173410 (PPP1CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100173410 (PPP1CB)
   04024 cAMP signaling pathway
    100173410 (PPP1CB)
   04022 cGMP-PKG signaling pathway
    100173410 (PPP1CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100173410 (PPP1CB)
   04218 Cellular senescence
    100173410 (PPP1CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100173410 (PPP1CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100173410 (PPP1CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100173410 (PPP1CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100173410 (PPP1CB)
   04921 Oxytocin signaling pathway
    100173410 (PPP1CB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100173410 (PPP1CB)
   04270 Vascular smooth muscle contraction
    100173410 (PPP1CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    100173410 (PPP1CB)
   04720 Long-term potentiation
    100173410 (PPP1CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100173410 (PPP1CB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100173410 (PPP1CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    100173410 (PPP1CB)
   05034 Alcoholism
    100173410 (PPP1CB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100173410 (PPP1CB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100173410 (PPP1CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100173410 (PPP1CB)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pon03021]
    100173410 (PPP1CB)
   03019 Messenger RNA biogenesis [BR:pon03019]
    100173410 (PPP1CB)
   03041 Spliceosome [BR:pon03041]
    100173410 (PPP1CB)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100173410 (PPP1CB)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100173410 (PPP1CB)
Transcription machinery [BR:pon03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100173410 (PPP1CB)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100173410 (PPP1CB)
Spliceosome [BR:pon03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100173410 (PPP1CB)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 100173410
NCBI-ProteinID: NP_001126427
Ensembl: ENSPPYG00000012529
UniProt: Q5R740 A0A2J8VNA3
LinkDB
Position
2A
AA seq 327 aa
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggacggggagctgaacgtggacagcctcatcacccggctgctggaggtacgagga
tgtcgtccaggaaagattgtgcagatgactgaagcagaagttcgaggcttatgtatcaag
tctcgggagatctttctcagccagcctattcttttggaattggaagcaccgctgaaaatt
tgtggagatattcatggacagtatacagatttactgagattatttgaatatggaggtttc
ccaccagaagccaactatcttttcttaggagattatgtggacagaggaaagcagtctttg
gaaaccatttgtttgctattggcttataaaatcaaatatccagagaacttctttctctta
agaggaaaccatgagtgtgctagcatcaatcgcatttatggattctatgatgaatgcaaa
cgaagatttaatattaaattgtggaagaccttcactgattgttttaactgtctgcctata
gcagccattgtggatgagaagatcttctgttgtcatggaggattgtcaccagacctgcaa
tctatggagcagattcggagaattatgagacctactgatgtccctgatacaggtttgctc
tgtgatttgctatggtctgatccagataaggatgtgcaaggctggggagaaaatgatcgt
ggtgtttcctttacttttggagctgatgtagtcagtaaatttctgaatcgtcatgattta
gatttgatttgtcgagctcatcaggtggtggaagatggatatgaattttttgctaaacga
cagttggtaaccttattttcagccccaaattactgtggcgagtttgataatgctggtgga
atgatgagtgtggatgaaactttgatgtgttcatttcagatattgaaaccatctgaaaag
aaagctaagtaccagtatggtggactgaattctggacgtcctgtcactccacctcgaaca
gctaatccaccgaagaaaaggtga

KEGG   Pongo abelii (Sumatran orangutan): 100444334
Entry
100444334         CDS       T01416                                 

Gene name
PPP1R12C
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12C isoform X1
  KO
K17457  protein phosphatase 1 regulatory subunit 12C
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04270  Vascular smooth muscle contraction
pon04510  Focal adhesion
pon04810  Regulation of actin cytoskeleton
pon04921  Oxytocin signaling pathway
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100444334 (PPP1R12C)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100444334 (PPP1R12C)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100444334 (PPP1R12C)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100444334 (PPP1R12C)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100444334 (PPP1R12C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100444334 (PPP1R12C)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100444334 (PPP1R12C)
SSDB
Motif
Pfam: PRKG1_interact Ank_2 Ank_4 Ank_5 Ank_3 Ank DUF4695
Other DBs
NCBI-GeneID: 100444334
NCBI-ProteinID: XP_024093718
Ensembl: ENSPPYG00000010400
LinkDB
Position
19
AA seq 782 aa
MSGEDGPAAGPGAAAAAARERRREQLRQWGARAGAEPGPGERRARTVRFERAAEFLAACA
GGDLDEARLMLRAADPGPGAELDPAAPPPARAVLDSTNADGISALHQACIDENLEVVRFL
VEQGATVNQADNEGWTPLHVAASCGYLDIARYLLSHGANIAAVNSDGDLPLDLAESDAME
GLLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHVAAAKGYI
EVMRLLLQAGYDPELRDGDGWTPLHAAAHWGVEDACRLLAEHGGGMDSLTHAGQRPCDLA
DEEVLSLLEELARKQEDLRNQKEASQSRGQEPQAPSSSKHRRSSVCRLSSREKISLQDLS
KERRPGGAGGPPIQDEDEGEEGPTEPPPAEPRTLNGVSSPPHPSPKSPMLPEEAPFSRRF
GLMKTGSYGALGPPERRTAEGAPGAGLQRSASSSWLEGTSTQAKELRLARITPTPSRKLP
EPSVLSEVTKPPPCLENSSPSSRIPEPESPAKPNVPTASTAPPADSRDRRRSYQMPVRDE
ESESQRKARSRLMRQSRRSTQGVTLTDLKEAEKAAGKAPESEKPAQSLDPSLRPRVPGVE
NSDSPAQRAEAPDGQGPGPQAPREHRKVGKEWRGPAEGEEAEPADRSQESSTLEGGPSAR
RQRSQRDLNPEPEPESEEPDGGFRKLYAELRRENERLREALTETTLRLAQLKVELERATQ
RQERFAERPALLELERFERRALERKAAELEEELKALSDLRADNQRLKDENAALIRVISKL
SK
NT seq 2349 nt   +upstreamnt  +downstreamnt
atgtccggagaggatggcccggcggctggcccgggggcggcggcggcggctgcccgggag
cggcgacgggagcagctgcggcagtggggggcgcgggcgggcgccgagcctggccccgga
gagcgccgcgcccgcaccgtccgcttcgagcgcgccgccgagttcctggcggcctgtgcg
ggcggcgacctggacgaggcgcgtctgatgctgcgcgccgccgaccctggccccggcgcc
gagctcgaccccgccgcgccgccgcccgcccgcgccgtgctggactccaccaacgcagac
ggcatcagcgccctgcaccaggcctgcattgatgagaacctggaggtggtgcgcttcttg
gtggagcagggcgccaccgtgaaccaggcagacaacgagggctggacgcccctgcacgtg
gccgcctcctgtggctacctggatatcgccaggtacctcctgagccacggggccaacatc
gccgccgtcaacagtgacggggacctgcccctggacctggccgagtcggacgccatggag
gggctgctgaaggcggagatcgcccgccgaggtgtggatgtggaggcagctaagcgggcg
gaagaggaattgctacttcatgacaccaggtgctggctgaatgggggtgccatgccagag
gcccggcacccccgcacaggcgcctctgccctgcacgtggctgctgccaagggctacatt
gaggtgatgaggttgctccttcaggctggctacgacccggagctccgggacggggacggc
tggactcccctgcacgcggcggcacactggggcgtggaggatgcctgccgcctgctggcc
gagcatggcgggggcatggactcgctgacccatgcggggcagcgtccctgtgacctggcc
gatgaggaagtactgagcctgttggaggaactggcccggaaacaggaggaccttcggaac
caaaaagaagcttcccagagccggggccaggagccccaagcgccctctagcagcaaacac
agaaggagctctgtgtgtcgtctgagcagtcgagagaagatttccctccaggacttgtcc
aaggagcgccggcctggtggggctggggggccccccatccaggacgaggatgagggggaa
gaaggtcccactgaaccaccccctgcagaacccagaaccctcaatggcgtctcctccccg
ccgcaccccagccctaagagccccatgctgcctgaagaggcccccttctccaggcgcttt
ggccttatgaagacaggaagttatggtgccctgggtcccccggaaaggcggacagcggag
ggagcccctggagctgggctgcagcgctcggcttcctcctcctggctggaagggacctcc
actcaggccaaggagctccgtcttgccagaattaccccgaccccctcccggaagctgccg
gagccctctgtcctgtctgaggtcaccaagcctcctccttgcttggagaactcctcgcct
tcctccaggattccggagcctgaatccccagcgaagccaaacgtccccacagcctccacg
gcgcccccagcggactcccgggacagacggaggtcctatcagatgcctgtgcgggatgag
gagtcggaatcccagagaaaagctcgctcccgtctcatgcgccagtctcggaggtccaca
cagggtgtgactctgacagacctgaaggaggcagagaaggctgcagggaaggccccagag
tcagagaagccagcgcagagcctggacccttccctgaggccccgcgtccctggagtggag
aactctgacagccctgcccagagagcagaggcgcccgacgggcagggtccgggaccgcag
gcgcccagggagcaccgcaaggtcggaaaggagtggagggggcctgcggagggggaggag
gcggagccggccgaccgcagccaggagtccagcaccctggagggcggcccctcagcccgc
aggcagcggtcgcagcgggacctcaacccagaacctgagccagaatcggaggagccggac
ggaggctttaggaagctgtatgcagagctgcgcagggagaatgagcggcttcgcgaggcc
ctgaccgagaccacgctgcggctggcgcagctcaaggtggagctggagcgggccacgcag
aggcaagaacgcttcgctgagaggccagcccttctggaactggagagattcgagcgcagg
gccctggaacgcaaggccgcagagctggaggaggagctgaaggccctgtctgacctccgc
gctgacaaccagcgcctcaaggatgagaatgcagcgttgatccgcgtcatcagcaaactc
tccaagtga

KEGG   Pongo abelii (Sumatran orangutan): 100458223
Entry
100458223         CDS       T01416                                 

Gene name
PPP1CC
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-gamma catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04114  Oocyte meiosis
pon04218  Cellular senescence
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04390  Hippo signaling pathway
pon04510  Focal adhesion
pon04611  Platelet activation
pon04720  Long-term potentiation
pon04728  Dopaminergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04921  Oxytocin signaling pathway
pon04931  Insulin resistance
pon05031  Amphetamine addiction
pon05034  Alcoholism
pon05168  Herpes simplex virus 1 infection
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100458223 (PPP1CC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100458223 (PPP1CC)
   04024 cAMP signaling pathway
    100458223 (PPP1CC)
   04022 cGMP-PKG signaling pathway
    100458223 (PPP1CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100458223 (PPP1CC)
   04218 Cellular senescence
    100458223 (PPP1CC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100458223 (PPP1CC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100458223 (PPP1CC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100458223 (PPP1CC)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100458223 (PPP1CC)
   04921 Oxytocin signaling pathway
    100458223 (PPP1CC)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100458223 (PPP1CC)
   04270 Vascular smooth muscle contraction
    100458223 (PPP1CC)
  09156 Nervous system
   04728 Dopaminergic synapse
    100458223 (PPP1CC)
   04720 Long-term potentiation
    100458223 (PPP1CC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100458223 (PPP1CC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100458223 (PPP1CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    100458223 (PPP1CC)
   05034 Alcoholism
    100458223 (PPP1CC)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100458223 (PPP1CC)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100458223 (PPP1CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100458223 (PPP1CC)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pon03021]
    100458223 (PPP1CC)
   03019 Messenger RNA biogenesis [BR:pon03019]
    100458223 (PPP1CC)
   03041 Spliceosome [BR:pon03041]
    100458223 (PPP1CC)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100458223 (PPP1CC)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100458223 (PPP1CC)
Transcription machinery [BR:pon03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100458223 (PPP1CC)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100458223 (PPP1CC)
Spliceosome [BR:pon03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100458223 (PPP1CC)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 100458223
NCBI-ProteinID: XP_002823789
Ensembl: ENSPPYG00000004955
UniProt: A0A663D8D3 H2NIN2
LinkDB
Position
12
AA seq 337 aa
MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRVASGLNPSIQKASNYRNNTVLYE
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcggatttagataaactcaacatcgacagcattatccaacggctgctggaagtgaga
gggtccaagcctggtaagaatgtccagcttcaggagaatgaaatcagaggactgtgctta
aagtctcgtgaaatctttctcagtcagcctatcctactagaacttgaagcaccactcaaa
atatgtggtgacatccatgggcaatactatgatttgctgcgactttttgagtacggtggt
ttcccaccagaaagcaactacctgtttcttggggactatgtggacaggggaaagcagtca
ttggagactatctgcctcttactggcctacaaaatcaaatatcctgagaatttttttctt
ctcagagggaaccatgaatgtgccagcatcaacagaatttatggattttatgatgaatgt
aaaagaagatacaacattaaactatggaaaactttcacagactgttttaactgtttaccg
atagcagccatcgtggatgagaagatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgcgaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggatatgaattttttgcaaag
aggcagttggtcactctgttttctgcgcccaattattgtggagagtttgacaatgcaggt
gccatgatgagtgtggatgaaacactaatgtgttcttttcagattttaaagcctgcagag
aaaaagaagccaaatgccacgagacctgtaacgcctccaagggttgcatcaggcctgaac
ccgtccattcagaaagcttcaaattatagaaacaatactgttctatacgagtga

KEGG   Pongo abelii (Sumatran orangutan): 100459799
Entry
100459799         CDS       T01416                                 

Gene name
PPP1CA
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-alpha catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04114  Oocyte meiosis
pon04218  Cellular senescence
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04390  Hippo signaling pathway
pon04510  Focal adhesion
pon04611  Platelet activation
pon04720  Long-term potentiation
pon04728  Dopaminergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04921  Oxytocin signaling pathway
pon04931  Insulin resistance
pon05031  Amphetamine addiction
pon05034  Alcoholism
pon05168  Herpes simplex virus 1 infection
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100459799 (PPP1CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100459799 (PPP1CA)
   04024 cAMP signaling pathway
    100459799 (PPP1CA)
   04022 cGMP-PKG signaling pathway
    100459799 (PPP1CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100459799 (PPP1CA)
   04218 Cellular senescence
    100459799 (PPP1CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100459799 (PPP1CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100459799 (PPP1CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100459799 (PPP1CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100459799 (PPP1CA)
   04921 Oxytocin signaling pathway
    100459799 (PPP1CA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100459799 (PPP1CA)
   04270 Vascular smooth muscle contraction
    100459799 (PPP1CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    100459799 (PPP1CA)
   04720 Long-term potentiation
    100459799 (PPP1CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100459799 (PPP1CA)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100459799 (PPP1CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    100459799 (PPP1CA)
   05034 Alcoholism
    100459799 (PPP1CA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100459799 (PPP1CA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100459799 (PPP1CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100459799 (PPP1CA)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pon03021]
    100459799 (PPP1CA)
   03019 Messenger RNA biogenesis [BR:pon03019]
    100459799 (PPP1CA)
   03041 Spliceosome [BR:pon03041]
    100459799 (PPP1CA)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100459799 (PPP1CA)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100459799 (PPP1CA)
Transcription machinery [BR:pon03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100459799 (PPP1CA)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100459799 (PPP1CA)
Spliceosome [BR:pon03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100459799 (PPP1CA)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 100459799
NCBI-ProteinID: XP_002821493
Ensembl: ENSPPYG00000002995
UniProt: A0A6D2XD44 A0A2J8U0C7
LinkDB
Position
11
AA seq 330 aa
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgtccgacagcgagaagctcaacctggactcgatcatcgggcgcctgctggaagtgcag
ggctcgcggcctggcaagaatgtacagctgacagagaacgagatccgcggtctgtgcttg
aaatcccgggagattttcctgagccagcccattcttctggagctggaggcacccctcaag
atctgcggtgacatacacggccagtactacgaccttctgcgactatttgagtatggcggt
ttccctcccgagagcaactacctctttctgggggactatgtggacaggggcaagcagtcc
ttggagaccatctgcctgctgctggcgtataagatcaagtaccccgagaacttcttcttg
ctccgtgggaaccacgagtgtgccagcatcaaccgcatctatggtttctacgatgagtgc
aagagacgctacaacatcaaactgtggaaaaccttcactgactgcttcaactgcctgccc
atcgcagccatagtggacgaaaagatcttctgctgccacggaggcctgtccccggacctg
cagtctatggagcagattcggcggatcatgcggcccacagatgtgcctgaccagggcctg
ctgtgtgacctgctgtggtctgaccctgacaaggacgtgcagggctggggcgagaacgac
cgtggcgtctcttttacctttggagccgaggtggtggccaagttcctccacaagcacgac
ttggacctcatctgccgagcacaccaggtggtagaagatggctatgagttctttgccaag
cggcagctggtgacacttttctcagctcccaactactgtggcgagtttgacaatgctggc
gccatgatgagcgtggacgagaccctcatgtgctccttccagatcctcaagcccgccgac
aagaacaaggggaagtacgggcagttcagtggcctgaaccctggaggccgacccatcacc
ccaccccgcaattccgccaaagccaagaaatag

KEGG   Pongo abelii (Sumatran orangutan): 103890237
Entry
103890237         CDS       T01416                                 

Gene name
PPP1R12B
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12B isoform X1
  KO
K12329  protein phosphatase 1 regulatory subunit 12B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04270  Vascular smooth muscle contraction
pon04510  Focal adhesion
pon04810  Regulation of actin cytoskeleton
pon04921  Oxytocin signaling pathway
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103890237 (PPP1R12B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103890237 (PPP1R12B)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103890237 (PPP1R12B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103890237 (PPP1R12B)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103890237 (PPP1R12B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    103890237 (PPP1R12B)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103890237 (PPP1R12B)
SSDB
Motif
Pfam: PRKG1_interact Ank_4 Ank_2 Ank_5 Ank Ank_3 MEDS
Other DBs
NCBI-GeneID: 103890237
NCBI-ProteinID: XP_024102859
LinkDB
Position
1
AA seq 1043 aa
MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGA
VFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQ
DNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQ
GVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAG
YELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLEM
LQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEMEEENKESSSS
SSEEEEGEDEASESETEKEADKKPEVFVNHSNSESKSSITEQIPAPAQNTFSASSARRFS
SGLFNKPEEPKDESPSSWRLGLRKTGSHNMLSEVANSREPIRDRGSSIYRSSSSPRISAL
LDNKDKERENKSYISSLAPRKLNSTSDIEEKENRESAVNLVRSGSYTRQLWRDEAKGNET
PQTIAPSTYVSTYLKSASFGRSSDPTSPYISANRNSSPATSPITIGSSTSRGSQWQPASS
CPAPISANTTASVHHGRTPHKSQADSTAEKTADNVSSSTPLCVITNRPLPSTANGVTATP
VLSITGTDSSVEAREKRRSYLTPVRDEEAESLRKARSRQARQTRRSTQGVTLTDLQEAER
TFSRSRAERQAQEQPREKPTDTEGLEGSPEKHEPSAVPATEAGEGQQPWGRSLDEEPICH
RLRCPAQPDKPTTPASPSTSRPSLYTSSHLLWTNRFSVPDSESSKTTTDTTTAKEMDKNE
NEEADLDEQSSKRLSVRERRRPKERRRGTGINFWTKDEDETDGSEEVKETWHERLSRLES
GGSNPTTSDSYGDRASARARREAREARLATLTSRVEEDSNRDYKKLYESALTENQKLKTK
LQEAQLELADIKSKLEKVAQQKQEKTSDRSSVLEMEKRERRALERKMSEMEEEMKVLTEL
KSDNQRLKDENGALIRVISKLSK
NT seq 3132 nt   +upstreamnt  +downstreamnt
atggcggagctggagcacctaggagggaagcgggcagagtcggcgcgaatgcggcgggca
gagcagcttcggcgctggcggggctcgctgacagagcaggagcctgcggagcgacgaggc
gcggggcggcagccgctgaccaggcgcgggagccccagggtccgcttcgaggacggtgct
gtctttctggccgcctgctctagcggggacaccgacgaggtgagaaagcttctggcaaga
ggtgctgatatcaacacggtcaacgtggacggcttgacagccctgcaccaggcgtgtatt
gatgaaaatttggacatggtgaagtttctggtggagaacagagccaatgtaaaccaacaa
gacaacgagggctggacaccccttcatgcagcagcttcctgtggctatctcaacatagca
gagtatttcattaatcacggagccagtgtaggtattgtcaatagtgaaggtgaagttccc
tctgaccttgcagaagagccagccatgaaggatcttcttctggagcaagtaaagaagcaa
ggagttgatctagagcagtcaagaaaagaagaagagcagcagatgttgcaggatgcccgc
cagtggctcaacagtgggaaaatagaggatgtgaggcaggctcgctcaggggctacagcc
cttcatgtggctgctgccaagggctactctgaagtcctcagacttttaatccaggctggc
tatgaactcaatgttcaggattatgatggctggactcccctccatgctgctgcacactgg
ggagtgaaggaggcttgctccatcctggcagaagcactttgtgacatggatattcgaaac
aaactgggccaaacaccatttgatgtggctgatgagggtctcgtggagcatttggagatg
ctccagaagaagcagaatgtgcttcgaagtgaaaaggagacacggaataaactcattgag
tcagacctgaacagcaagattcagagtgggttctttaagaacaaagagaagatgctctat
gaggaggagacacctaagtcccaagaaatggaggaagaaaacaaagaatctagtagctcc
agctcagaggaggaggaaggtgaagatgaagcttctgagtcggaaactgagaaggaagca
gataaaaagccggaagtctttgtcaatcattccaactctgaaagcaagagtagtatcaca
gagcagataccagcaccagctcaaaataccttctctgcctcttctgctaggaggttctct
tctggcctttttaacaagccagaagagcccaaagatgagtctccttcttcatggagattg
ggactgagaaaaactggcagccacaacatgctgagtgaggtggccaattccagggaacct
ataagggaccgaggctcttccatctaccgctcctcttcaagccctcggatttctgctcta
ctagacaacaaagataaggagagagaaaacaaaagctatattagttcactagcaccccgg
aagctcaacagcacaagtgatattgaagaaaaggagaacagagaatcagctgttaatcta
gtgaggagtggctcctatacccggcagctatggagggatgaagcaaaaggaaatgaaacc
ccacaaacaattgctccctccacctatgtatcaacttacttgaaaagtgcttcatttggt
agaagtagtgaccccacaagtccctacatttcagccaatcgcaattcatctcctgctacc
tcacccattaccattggttcatctacctctcggggcagccagtggcaacctgcctcttct
tgccctgcaccaatcagtgcaaacactactgcatctgtacatcatggcaggactcctcac
aaatcccaggccgactcgacagcagagaaaacagcagacaatgtctcttctagcaccccg
ctctgtgtgatcaccaatcgccctctgcctagcactgccaatggggttacagctactcct
gtgctctccattactggaacagattcctctgtggaagccagggagaagaggaggtcctat
ctgactcctgtacgggatgaggaagcagagtctttacggaaagcacgctccagacaagct
cggcagacacgaaggtctactcaaggtgtcaccctaacagaccttcaagaagcagaaagg
acattcagccggtcgagggcagagaggcaagctcaggagcagcctcgtgagaagcccaca
gacactgaagggcttgaggggagccctgagaagcatgagccctcagcagttccagcaaca
gaagctggggagggccagcagccctggggcagaagtctggatgaagagcctatctgtcat
cgcctgaggtgcccagctcagccagacaaacccaccacgccagcatctccttctacatca
agaccctcactctacaccagttcccacctgctatggacaaatagattttcagtccctgat
tctgagagttcaaagactaccacagacactaccactgcaaaggaaatggacaaaaatgag
aatgaagaagcagatttggatgagcagtcctctaagaggctgtccgtccgagagaggagg
cggcccaaggaacgacgaagaggcacaggcatcaatttctggacaaaggatgaggatgaa
actgatggctctgaagaggtcaaagaaacatggcatgaaagactttctaggttggaatcg
ggaggtagtaatcctacaaccagtgattcttatggtgaccgggcttcagcaagagcccgt
cgggaggcccgggaggcccgcctagccaccctgaccagccgtgtagaagaagacagcaac
agagattataaaaaactctatgagagtgctctgactgaaaaccaaaaactgaaaacaaaa
cttcaggaagcccagctagagctagcagatataaagtccaagcttgagaaggtggcccag
cagaaacaagaaaagacctctgaccgatcatcagtgctggagatggagaaacgggagagg
cgagccttggagcgcaaaatgtcagaaatggaggaagaaatgaaggtgttaacagaactg
aaatccgacaaccagaggctgaaagatgaaaatggtgccctcatcagagtcatcagcaaa
ctgtccaagtag

DBGET integrated database retrieval system