KEGG   Pongo abelii (Sumatran orangutan): 100172659
Entry
100172659         CDS       T01416                                 

Gene name
SLC7A11
Definition
(RefSeq) cystine/glutamate transporter
  KO
K13869  solute carrier family 7 (L-type amino acid transporter), member 11
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100172659 (SLC7A11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100172659 (SLC7A11)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   100172659 (SLC7A11)
SSDB
Motif
Pfam: AA_permease_2 AA_permease DoxX_2
Other DBs
NCBI-GeneID: 100172659
NCBI-ProteinID: NP_001125734
Ensembl: ENSPPYG00000015066
UniProt: Q5RAG7
LinkDB
Position
4
AA seq 501 aa
MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGA
GIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGP
LPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLN
SMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFY
YGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLS
NAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHV
RKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRP
FKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGSVITLTGVPAYYLFIIWDKKPRWFRIM
SEKITRTLQIILEVVPEEDKL
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggtcagaaagcctgttgtgtccaccatctccaaaggaggttacctgcagggaaatgtt
aacgggaggctgccttccctgggcaacaaggagccacctgggcaggagaaagtgcagctg
aagaggaaagtcactttactgaggggagtctccattatcattggcaccatcattggagca
ggaatcttcatctctcctaagggcgtgctccagaacacgggcagcgtgggcatgtctctg
accatctggacggtgtgtggggtcctgtcactatttggagctttgtcttatgctgaattg
ggaacaactataaagaaatctggaggtcattacacatatattttggaagtctttggtcca
ttaccagcttttgtacgagtctgggtggaactcctcataatacgccctgcagctactgct
gtgatatccctggcatttggacgctacattctggaaccattttttatccaatgtgaaatc
cctgaacttgcgatcaagctcattacagctgtgggcataactgtagtgatggtcctaaat
agcatgagtgtcagctggagcgcccggatccagattttcttaaccttttgcaagctcaca
gcaattctgataattatagtccctggagttatgcagctaattaaaggtcaaacgcagaac
tttaaagacgccttttcaggaagagattcaagtattacgcggttgccactggctttttat
tatggaatgtatgcatatgctggctggttttacctcaactttgttactgaagaagtagaa
aaccctgaaaaaaccattccccttgcaatatgtatatccatggccattgtcaccattggc
tatgtgctgacaaatgtggcctactttacgaccattaatgctgaggagctgctgctttca
aatgcagtggcagtgaccttttctgagcggctactgggaaatttctcattagcagttccg
atctttgttgccctctcctgctttggctccatgaacggtggtgtgtttgctgtctccagg
ttattctatgttgcgtctcgagagggtcaccttccagaaatcctctccatgattcatgtc
cgcaagcacactcctctaccagctgttattgttttgcaccctttgacaatgataatgctc
ttctctggagacctcgacagtcttttgaatttcctcagttttgccaggtggctttttatt
gggctggcagttgctgggctgatttatcttcgatacaaatgcccagatatgcatcgtcct
ttcaaggtgccactgttcatcccagctttgttttccttcacatgcctcttcatggttgcc
ctttccctctattcggacccatttagtacagggattggctccgtcatcactctgactgga
gtccctgcgtattatctctttattatatgggacaagaaacccaggtggtttagaataatg
tcagagaaaataaccagaacattacaaataatactggaagttgtaccagaagaagataag
ttatga

DBGET integrated database retrieval system