KEGG   Pongo abelii (Sumatran orangutan): 100172676
Entry
100172676         CDS       T01416                                 

Gene name
TRAF1
Definition
(RefSeq) TNF receptor-associated factor 1
  KO
K03172  TNF receptor-associated factor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04064  NF-kappa B signaling pathway
pon04210  Apoptosis
pon04668  TNF signaling pathway
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05203  Viral carcinogenesis
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100172676 (TRAF1)
   04668 TNF signaling pathway
    100172676 (TRAF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100172676 (TRAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100172676 (TRAF1)
   05202 Transcriptional misregulation in cancer
    100172676 (TRAF1)
   05203 Viral carcinogenesis
    100172676 (TRAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100172676 (TRAF1)
SSDB
Motif
Pfam: TRAF_BIRC3_bd
Other DBs
NCBI-GeneID: 100172676
NCBI-ProteinID: NP_001125751
Ensembl: ENSPPYG00000019557
UniProt: Q5RAE4
LinkDB
Position
9
AA seq 416 aa
MASSSGSSPRPAPDENEFPFGCPPTVCQDPKEPRALCCTGCLSENPRNGEDQICSKCRGE
DLQSISPGSRLRTQEKAHPEVAEAGVGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLL
GFMKQWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQH
FMKEKLLAELEGKLRVFENIVAVLDKEVEASHLALATSIHQSQLDRERILSLEQRVVEPQ
QTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAK
YGYKLCLRLYLNGDGTGKRTHLSLFIVLMRGEYDALLPWPFRNKVTFMLLDQNNREHAID
AFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVETST
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggcctccagctcaggcagcagccctcgcccggcccctgatgagaatgagtttcccttt
gggtgccctcccaccgtctgccaggacccaaaggagcccagggctctctgctgtacaggc
tgtctctctgagaacccgaggaacggcgaggatcagatctgctccaaatgcagaggggaa
gacctccagtctataagcccaggaagccgtcttcgaactcaggagaaggctcaccccgag
gtggccgaggctggagttgggtgcccctttgcaggtgtcggctgctccttcaagggaagc
ccacagtctgtgcaagagcatgaggtcacctcccagacctcccacctaaacctgctgctg
gggttcatgaaacagtggaaggcccggctgggctgtggcctggagtctgggcccatggcc
ctggagcagaacctgtcagacctgcagctgcaggcagccgtggaagtggcgggggacctg
gaggtcgattgctaccgggcaccctgctccgagagccaggaggagctggccctgcagcac
ttcatgaaggagaagcttctggctgagctggaggggaagctgcgtgtgtttgagaatatt
gttgctgttctcgacaaggaggtggaggcctcccacctggccctggccacctccatccac
cagagccagctggaccgtgagcgcatcctgagcttggagcagagggtggtggagccgcag
cagaccctggcccagaaagaccaggccctgggcaagctggagcagagcttgcgcctcatg
gaggaggcctccttcgatggcaccttcctgtggaagatcaccaacgtcaccaggcggtgc
catgagtcggcctgtggcaggaccgtcagcctcttctccccagccttctacactgccaag
tatggctacaagttgtgcctgcggctgtacctgaatggagatggcactggaaagaggacc
cacctgtcgctcttcatcgtgctcatgcgaggggagtatgatgcgctgctgccgtggcct
ttccgaaacaaggtcaccttcatgctgctggaccagaacaaccgtgagcacgccattgac
gccttccggcctgacctaagctcagcatccttccagaggccccagagtgaaaccaatgtg
gccagtggctgcccactcttctttcccctcagcaaactgcagtcacccaagcacgcctat
gtgaaggacgacacgatgtttctcaagtgcattgtggagaccagcacttag

KEGG   Pongo abelii (Sumatran orangutan): 100431446
Entry
100431446         CDS       T01416                                 

Gene name
TRAF4
Definition
(RefSeq) TNF receptor-associated factor 4
  KO
K09848  TNF receptor-associated factor 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04657  IL-17 signaling pathway
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100431446 (TRAF4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100431446 (TRAF4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100431446 (TRAF4)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-Nse zf-C3HC4_4 zf-RING_5 zf-RING_2 zf-RING_6 zf-C3HC4_3 zf-TRAF_2 zf-rbx1 Sina
Other DBs
NCBI-GeneID: 100431446
NCBI-ProteinID: XP_024090790
Ensembl: ENSPPYG00000008111
LinkDB
Position
17
AA seq 470 aa
MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLP
LDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMK
LSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLL
AQHATSECPKRTQPCTYCSKEFVFDTIQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLK
DSCNTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMCALVSRQRQELQELRRELE
ELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEG
THLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP
GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKILS
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgcctggcttcgactacaagttcttggagaagcccaagcgacggctgctatgcccactg
tgcgggaagcccatgcgcgagcctgtgcaggtttccacctgcggccaccgtttctgcgac
acctgcctgcaggagttcctcagtgaaggagtcttcaagtgccctgaggaccagcttcct
ctggactatgccaagatctacccagacccggagctggaagtacaagtattgggcctgcct
atccgctgcatccacagtgaggagggctgccgctggagtgggccactacgtcatctacag
ggccacctgaatacctgcagcttcaacgtcattccctgccctaatcgctgccccatgaag
ctgagccgccgtgatctacctgcacacttgcagcacgactgccccaagcggcgcctcaag
tgcgagttttgtggctgtgacttcagtggggaggcctatgagagccatgagggtatgtgc
ccccaggagagtgtctactgtgagaataagtgtggtgcccgcatgatgcggcggctgctg
gcccagcatgccacctctgagtgccccaagcgcactcagccctgcacttactgcagtaag
gagttcgtctttgacaccatccagagccaccagtaccagtgcccaaggctgcctgttgcc
tgccccaaccagtgtggtgtgggcactgtggctcgggaggacctgccaggccatctgaag
gacagctgtaacaccgccctggtgctctgcccattcaaagactccggctgcaagcacagg
tgccctaagctggcaatggcacggcatgtggaggagagtgtgaagccacatctggccatg
atgtgtgccctggtgagccggcaacggcaggagctgcaggagcttcggcgagagctggag
gagctatcagtgggcagtgatggcgtgctcatctggaagattggcagctatggacgacgg
ttacaggaggccaaggccaagcccaaccttgagtgcttcagcccagccttctacacacat
aagtatggttacaagctgcaggtgtctgcattcctcaatggcaatggcagtggcgagggc
acacacctctcgctgtacattcgtgtgctgcctggtgcctttgacaatctccttgagtgg
ccctttgcccgccgtgtcaccttctccctgctggatcagagcgaccctgggctggctaaa
ccacagcacgtcaccgagaccttccaccccgacccaaactggaagaatttccagaagccg
ggcacatggcggggctccctggatgagagttctctgggctttggttatcccaagttcatc
tcccaccaggacattcgaaagcgaaactatgtgcgggatgatgcagtcttcatccgtgct
gctgttgaactgccccggaagatcctcagctga

KEGG   Pongo abelii (Sumatran orangutan): 100449432
Entry
100449432         CDS       T01416                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor-associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04064  NF-kappa B signaling pathway
pon04120  Ubiquitin mediated proteolysis
pon04140  Autophagy - animal
pon04144  Endocytosis
pon04380  Osteoclast differentiation
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04722  Neurotrophin signaling pathway
pon05132  Salmonella infection
pon05133  Pertussis
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100449432 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100449432 (TRAF6)
   04064 NF-kappa B signaling pathway
    100449432 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100449432 (TRAF6)
   04140 Autophagy - animal
    100449432 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100449432 (TRAF6)
   04621 NOD-like receptor signaling pathway
    100449432 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    100449432 (TRAF6)
   04657 IL-17 signaling pathway
    100449432 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100449432 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100449432 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100449432 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100449432 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100449432 (TRAF6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100449432 (TRAF6)
   05135 Yersinia infection
    100449432 (TRAF6)
   05133 Pertussis
    100449432 (TRAF6)
   05152 Tuberculosis
    100449432 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100449432 (TRAF6)
   05161 Hepatitis B
    100449432 (TRAF6)
   05160 Hepatitis C
    100449432 (TRAF6)
   05171 Coronavirus disease - COVID-19
    100449432 (TRAF6)
   05162 Measles
    100449432 (TRAF6)
   05168 Herpes simplex virus 1 infection
    100449432 (TRAF6)
   05169 Epstein-Barr virus infection
    100449432 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100449432 (TRAF6)
   05140 Leishmaniasis
    100449432 (TRAF6)
   05142 Chagas disease
    100449432 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100449432 (TRAF6)
   04121 Ubiquitin system [BR:pon04121]
    100449432 (TRAF6)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100449432 (TRAF6)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100449432 (TRAF6)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100449432 (TRAF6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 SlyX U-box zf-RING_11 Tropomyosin_1 Spc29 DM ADIP EzrA Dynactin_p22 DUF16 AAA_13 PspA_IM30 UPF0242 FliJ DUF3450 Filament Sina
Other DBs
NCBI-GeneID: 100449432
NCBI-ProteinID: XP_002821919
Ensembl: ENSPPYG00000003350
UniProt: A0A2J8WFR2
LinkDB
Position
11
AA seq 522 aa
MSLLNCENSCGSSQSESDCCVAMASSCSAATKDDSVGGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILK
DCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSLIPDSGYISEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgagtctgctaaactgtgaaaacagctgtggatccagccagtctgaaagtgactgctgt
gtggccatggccagctcctgtagcgctgcaacaaaagatgatagtgtgggtggaactgcc
agcacggggaacctctccagctcatttatggaggagatccagggatatgatgtagagttt
gacccacccctggaaagcaaatatgaatgccccatctgcctgatggcattacgagaagca
gtgcaaacgccatgcggccataggttctgcaaagcctgcatcataaaatcaataagggat
gcaggtcacaaatgtccagttgacaatgaaatactgctggaaaatcaactatttccagac
aattttgcaaaacgtgagattctttctctgatggtgaagtgtccaaatgaaggttgtttg
cacaagatggaactgagacatcttgaggatcatcaagcacattgtgagtttgctcttatg
gattgtccccaatgccagcgtcctttccaaaaatttcatattaatattcacattctgaag
gattgtccaaggagacaggtttcttgtgacaactgtgctgcatcaatggcatttgaagat
aaagagatccatgaccagaactgtcctttggcaaatgtcatctgtgaatactgcaatact
atactcatcagagaacagatgcctaatcattatgatctagactgccctacagccccaatt
ccatgcacattcagtacttttggttgccatgaaaagatgcagaggaatcacttggcacgc
cacctacaagagaacacccagtcacacatgagaatgttggcccaggctgttcatagtttg
agccttatacctgactctgggtatatctcagaggtccggaatttccaggaaactattcac
cagttagagggtcgccttgtaagacaagaccatcaaatccgggagctgactgctaaaatg
gaaactcagagtatgtatgtaagtgagctcaaacgaaccattcgaacccttgaggacaaa
gttgctgaaatcgaagcacagcagtgcaatggaatttatatttggaagattggcaacttt
ggaatgcatttgaaatgtcaagaagaggagaaacctgttgtgattcatagccctggattc
tacactggcaaacccgggtacaaactgtgcatgcgcttgcaccttcagttaccgactgct
cagcgctgtgcaaactatatatccctttttgtccacacaatgcaaggagaatatgacagc
cacctcccttggcccttccagggtacaatacgccttacaattcttgatcagtctgaagca
cctgtaaggcaaaaccacgaagagataatggatgccaaaccagagctgcttgctttccag
cgacccacaatcccacggaacccaaaaggctttggctatgtaacttttatgcatctggaa
gccctaagacaaagaactttcattaaggatgacacattattagtgcgctgtgaggtctcc
acccgctttgacatgggtagccttcggagggagggttttcagccacgaagtactgatgca
ggggtatag

KEGG   Pongo abelii (Sumatran orangutan): 100453867
Entry
100453867         CDS       T01416                                 

Gene name
TRAF5
Definition
(RefSeq) TNF receptor-associated factor 5 isoform X2
  KO
K09849  TNF receptor-associated factor 5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04064  NF-kappa B signaling pathway
pon04217  Necroptosis
pon04621  NOD-like receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04668  TNF signaling pathway
pon05163  Human cytomegalovirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100453867 (TRAF5)
   04668 TNF signaling pathway
    100453867 (TRAF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100453867 (TRAF5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100453867 (TRAF5)
   04657 IL-17 signaling pathway
    100453867 (TRAF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100453867 (TRAF5)
   05203 Viral carcinogenesis
    100453867 (TRAF5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100453867 (TRAF5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100453867 (TRAF5)
   05168 Herpes simplex virus 1 infection
    100453867 (TRAF5)
   05163 Human cytomegalovirus infection
    100453867 (TRAF5)
   05169 Epstein-Barr virus infection
    100453867 (TRAF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100453867 (TRAF5)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100453867 (TRAF5)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-TRAF_2 zf-ACC Spc29 Sina ATG16 zf-RING_6 zf-RING_UBOX zf-RING_2 Acetyltransf_11 DUF4941 BORCS8 Mt_ATP_synt FlaC_arch PHM7_cyt DUF4279
Other DBs
NCBI-GeneID: 100453867
NCBI-ProteinID: XP_002809541
Ensembl: ENSPPYG00000000244
UniProt: A0A6D2XMG5 A0A2J8V6G2
LinkDB
Position
1
AA seq 557 aa
MAYSEEHKGMPCGFIRQNSGNSISLDFEPNIEYQFVERLEERYKCAFCHSVLHNPHQTGC
GHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKV
ILGRYQDHLQQCLFQAVQCSNEKCREPVLRKDLKEHLSAYCQFREEKCLYCKKDVVVINL
QNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQE
HERSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFG
KNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLE
NNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREA
VDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQ
RVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYLKD
DTLFLKVAVDLTDLEDL
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggcttattcagaagagcataaaggtatgccctgtggtttcatccgccagaattccggc
aactccatttccttggactttgagcccaatatagagtaccagtttgtggagcggttggaa
gagcgctacaaatgtgccttctgccactcggtgcttcacaacccccaccagacaggatgt
gggcaccgcttctgccagcactgcatcctgtccctgagagaattaaacacagtgccaatc
tgccctgtagataaggaggtcatcaaatctcaggaggtttttaaagacaattgctgcaaa
agagaagtcctcaacttatatgtatattgcagcaatgctcctggatgtaatgccaaggtt
attctgggccggtaccaggatcaccttcagcagtgcttatttcaagctgtgcagtgttct
aatgagaagtgccgggaaccagtcctacggaaagacctgaaagagcatttgagtgcatac
tgtcagtttcgagaggaaaaatgcctttattgcaaaaaggatgtggtagtcatcaatcta
cagaatcatgaggaaaacttgtgtcctgaatacccagtattttgtcccaacaattgtgcg
aagattattctaaaaactgaggtggatgaacacctggctgtatgtcctgaagctgagcaa
gactgtccttttaagcactatggctgtgctgtaacggataaacggaggaacctgcaggaa
catgagcgttcagctttacgggagcacatgcgtttggttttggaaaagaatgtccaatta
gaagaacagatttctgacttacacaagagcctagaacagaaagaaagtaaaatccagcag
ctagcagaaactataaagaaacttgaaaaggagttcaagcagtttgcacagttgtttggc
aaaaatggaagcttcctcccaaacatccaggtttttgccagtcacattgacaagtcagct
tggctagaagctcaagtgcatcaattattacaaatggttaaccagcaacaaaataaattt
gacctgaggcctttgatggaagcagttgatacagtgaaacagaaaattaccctgctagaa
aacaatgatcaaagattagctgttttagaagaggaaactaacaaacatgatacccacatt
aatattcataaagcacagctgagtaaaaatgaagagcgatttaaactgctggagggtact
tgctataatggaaagctcatttggaaggtgacagattacaagatgaagaagagagaggcg
gtggatgggcacacagtgtccatcttcagccagtccttctacaccagccgctgtggctac
cggctctgtgctagagcatacctgaatggggatgggtctgggaaggggacacacctgtcc
ctatactttgtggtcatgcgaggagagtttgactcactgttgcagtggccattcaggcag
agggtgaccctgatgcttctggaccagagtggcaaaaagaacattatggagaccttcaag
cctgaccccaatagcagcagctttaaaagacctgatggggagatgaacattgcatctggc
tgtccccgctttgtggctcattctgttttggagaatgccaagaacgcctaccttaaagat
gacactctgttcttgaaagtggccgtggacttaactgacctggaggatctctag

KEGG   Pongo abelii (Sumatran orangutan): 100458089
Entry
100458089         CDS       T01416                                 

Gene name
TRAF2
Definition
(RefSeq) TNF receptor-associated factor 2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04064  NF-kappa B signaling pathway
pon04071  Sphingolipid signaling pathway
pon04141  Protein processing in endoplasmic reticulum
pon04210  Apoptosis
pon04217  Necroptosis
pon04380  Osteoclast differentiation
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04668  TNF signaling pathway
pon04920  Adipocytokine signaling pathway
pon04932  Non-alcoholic fatty liver disease
pon05010  Alzheimer disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05135  Yersinia infection
pon05160  Hepatitis C
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100458089 (TRAF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100458089 (TRAF2)
   04064 NF-kappa B signaling pathway
    100458089 (TRAF2)
   04668 TNF signaling pathway
    100458089 (TRAF2)
   04071 Sphingolipid signaling pathway
    100458089 (TRAF2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100458089 (TRAF2)
   04217 Necroptosis
    100458089 (TRAF2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100458089 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    100458089 (TRAF2)
   04657 IL-17 signaling pathway
    100458089 (TRAF2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100458089 (TRAF2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100458089 (TRAF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100458089 (TRAF2)
   05203 Viral carcinogenesis
    100458089 (TRAF2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100458089 (TRAF2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100458089 (TRAF2)
   05014 Amyotrophic lateral sclerosis
    100458089 (TRAF2)
   05016 Huntington disease
    100458089 (TRAF2)
   05017 Spinocerebellar ataxia
    100458089 (TRAF2)
   05022 Pathways of neurodegeneration - multiple diseases
    100458089 (TRAF2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100458089 (TRAF2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100458089 (TRAF2)
   05135 Yersinia infection
    100458089 (TRAF2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100458089 (TRAF2)
   05160 Hepatitis C
    100458089 (TRAF2)
   05168 Herpes simplex virus 1 infection
    100458089 (TRAF2)
   05163 Human cytomegalovirus infection
    100458089 (TRAF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100458089 (TRAF2)
   05169 Epstein-Barr virus infection
    100458089 (TRAF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100458089 (TRAF2)
   04121 Ubiquitin system [BR:pon04121]
    100458089 (TRAF2)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100458089 (TRAF2)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100458089 (TRAF2)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100458089 (TRAF2)
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_6 zf-C3HC4_4 MATH SlyX
Other DBs
NCBI-GeneID: 100458089
NCBI-ProteinID: XP_003777545
Ensembl: ENSPPYG00000019790
UniProt: A0A2J8RMN7
LinkDB
Position
9
AA seq 501 aa
MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLAS
ILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKE
YESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHE
VCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEAQWL
REHLAMLLSSVLEAKPLSGDQSHAGSELLQRCESLENKTATFENIVCVLNREVERVAMTA
EACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISD
FARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDA
LLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEA
KNSYVRDDAIFIKAIVDLTGL
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggctgcagctagcgtgaccccccctggctccctggagttgctacagcccggcttctcc
aagaccctcctggggaccaagctggaagccaagtacctgtgctccgcctgcagaaacgtc
ctccgcaggcccttccaggcgcagtgtggccaccggtactgctccttctgcttggccagc
atcctcagctctgggcctcagaactgtgctgcctgtgttcacgagggcatatatgaagaa
ggcatttctattttagaaagcagttcggccttcccagataatgctgcccgcagggaggtg
gagagcctgccggccgtctgtcccagtgatgggtgcacctggaaggggaccctgaaagaa
tacgagagctgccacgaaggccgctgcccactcatgctgaccgaatgtcccgcgtgcaaa
ggcctggtccgccttggtgaaaaggagcgccacctggagcacgagtgcccagagagaagc
ctgagctgccggcattgccgggcgccctgctgcggagcggacgtgaaggcgcaccacgag
gtctgccctaagttccccttgacttgtgacggctgcggcaagaagaagatcccccgggag
aagtttcaggaccacgtcaagacttgtggcaagtgtcgagtcccttgcagattccacgcc
atcggctgcctcgagacggtagagggtgagaaacagcaggagcatgaggcgcagtggctg
cgggagcacctggccatgctactgagctcggtgctggaggcaaagcccctctcgggagac
cagagccacgcggggtcagagctcctgcagaggtgcgagagcctggagaacaagacggcc
acttttgagaacattgtctgcgtcctgaaccgggaggtggagagggtggccatgactgcc
gaggcctgcagccggcagcaccggctggaccaagacaagattgaagccctgagtagcaag
gtgcagcagctagagaggagcatcggcctcaaggacctggcgatggccgacctggagcag
aaggtcttggagatggaggcatccacctacgatggggtcttcatctggaagatctcagac
tttgccaggaagcgccaggaagctgtggctggccgcacacccgccatcttctccccagcc
ttctacaccagcaggtacggctacaagatgtgtctgcgtatctacctgaatggcgacggc
accgggcgaggaacacacctgtccctcttctttgtggtgatgaagggcccgaatgacgcc
ctgctgcggtggcccttcaaccagaaggtgaccttaatgctgcttgaccagaataaccgg
gagcacgtgattgacgccttcaggccggatgtgacctcgtcctcttttcagaggccagtc
aacgacatgaacatcgcaagcggctgccctctcttctgccccgtctccaagatggaggcc
aagaattcctacgtgcgggacgatgccatcttcatcaaggccattgtggacctgacaggg
ctctaa

KEGG   Pongo abelii (Sumatran orangutan): 100460079
Entry
100460079         CDS       T01416                                 

Gene name
TRAF3
Definition
(RefSeq) TNF receptor-associated factor 3 isoform X1
  KO
K03174  TNF receptor-associated factor 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04064  NF-kappa B signaling pathway
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04668  TNF signaling pathway
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100460079 (TRAF3)
   04668 TNF signaling pathway
    100460079 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100460079 (TRAF3)
   04621 NOD-like receptor signaling pathway
    100460079 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    100460079 (TRAF3)
   04657 IL-17 signaling pathway
    100460079 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460079 (TRAF3)
   05203 Viral carcinogenesis
    100460079 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100460079 (TRAF3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100460079 (TRAF3)
   05160 Hepatitis C
    100460079 (TRAF3)
   05171 Coronavirus disease - COVID-19
    100460079 (TRAF3)
   05164 Influenza A
    100460079 (TRAF3)
   05162 Measles
    100460079 (TRAF3)
   05168 Herpes simplex virus 1 infection
    100460079 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100460079 (TRAF3)
   05169 Epstein-Barr virus infection
    100460079 (TRAF3)
   05165 Human papillomavirus infection
    100460079 (TRAF3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 ATG16 Crescentin zf-C3HC4_2 MPS2 Tropomyosin_1 Spc7 Cast Spc29 zf-RING_4 KxDL T3SSipB FliJ BLOC1_2 DUF1664 Exonuc_VII_L Fib_alpha GAS SPATA24 DUF3450
Other DBs
NCBI-GeneID: 100460079
NCBI-ProteinID: XP_024087683
Ensembl: ENSPPYG00000006162
LinkDB
Position
14
AA seq 568 aa
MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCRLVL
CSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNE
SRGCAEQLTLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHC
KSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggagtcgagtaaaaagatggactctcctggcgcgctgcagactaacccaccgctaaag
ctgcacactgaccgtagtgctgggacgccagtttttgtccctgaacaaggaggttacaag
gaaaagtttgtgaagacagtggaggacaagtacaagtgtgagaagtgccgcctggtgctg
tgcagcccaaagcagaccgagtgtgggcaccgcttctgcgagagctgcatggccgccctg
ctgagctcttcaagtccaaaatgtacagcgtgtcaagagagcatcgttaaagataaggtg
tttaaggataattgctgcaagagagaaattctggctcttcagatctattgtcggaatgaa
agcagaggttgtgcagagcagttaacgctgggacatctgctggtgcatttaaaaaatgat
tgccattttgaagagcttccatgtgtgcgtcctgactgcaaagaaaaggtcttgaggaaa
gacctgcgagaccacgtggagaaggcgtgtaaataccgggaagccacgtgcagccactgc
aagagtcaggttccgatgatcgcgctgcagaaacacgaagacaccgactgtccctgcgtg
gtggtatcctgccctcacaagtgcagcgtccagactctcctgaggagcgagttgagtgca
cacttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgtt
tttcaggggacaaaccagcagatcaaggcccacgaggccagctccgccgtgcagcacgtc
aacctgctgaaggagtggagcaactcgctcgaaaagaaggtttccttgttgcagaatgaa
agtgtagaaaaaaacaagagcatacaaagtttgcacaatcagatatgtagctttgaaatt
gaaattgagagacaaaaggaaatgcttcgaaataatgaatcaaaaatccttcatttacag
cgagtgatagacagccaagcagagaaactgaaggagctcgacaaggagatccggcccttc
cggcagaactgggaggaagcagacagcatgaagagcagcgtggagtccctccagaaccgc
gtgactgagctggagagcgtggacaagagcgcggggcaagtggctcggaacacaggcctg
ctggagtcccagctgagccggcatgaccagatgctgagtgtgcacgacatccgcctggcc
gacatggacctgcgcttccaggtcctggagaccgccagctacaatggagtgctcatctgg
aagattcgcgactacaagcggcggaagcaggaggccgtcatggggaagaccctgtccctt
tacagccagcctttctacaccggctactttggctataagatgtgtgccagggtctacctg
aacggggacgggatggggaaggggacgcacttgtcgctgttttttgtcatcatgcgtggg
gaatacgacgccctgcttccttggccgtttaagcagaaagtgacactcatgctgatggat
caggggtcctctcgacgccatttgggagatgcgttcaagcccgaccccaacagcagcagc
ttcaagaagcccactggagagatgaatatcgcctctggctgcccagtctttgtggcccaa
actgttctagaaaatgggacatatattaaagatgatacaatttttattaaagtcatagtg
gatacttcggatctgcccgatccctga

DBGET integrated database retrieval system