KEGG   Pongo abelii (Sumatran orangutan): 100172679
Entry
100172679         CDS       T01416                                 

Gene name
GNAI1
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04071  Sphingolipid signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04360  Axon guidance
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04670  Leukocyte transendothelial migration
pon04713  Circadian entrainment
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04730  Long-term depression
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04921  Oxytocin signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04924  Renin secretion
pon04926  Relaxin signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04971  Gastric acid secretion
pon05012  Parkinson disease
pon05030  Cocaine addiction
pon05032  Morphine addiction
pon05034  Alcoholism
pon05133  Pertussis
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05163  Human cytomegalovirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100172679 (GNAI1)
   04371 Apelin signaling pathway
    100172679 (GNAI1)
   04071 Sphingolipid signaling pathway
    100172679 (GNAI1)
   04024 cAMP signaling pathway
    100172679 (GNAI1)
   04022 cGMP-PKG signaling pathway
    100172679 (GNAI1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100172679 (GNAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100172679 (GNAI1)
   04670 Leukocyte transendothelial migration
    100172679 (GNAI1)
   04062 Chemokine signaling pathway
    100172679 (GNAI1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100172679 (GNAI1)
   04915 Estrogen signaling pathway
    100172679 (GNAI1)
   04914 Progesterone-mediated oocyte maturation
    100172679 (GNAI1)
   04921 Oxytocin signaling pathway
    100172679 (GNAI1)
   04926 Relaxin signaling pathway
    100172679 (GNAI1)
   04935 Growth hormone synthesis, secretion and action
    100172679 (GNAI1)
   04928 Parathyroid hormone synthesis, secretion and action
    100172679 (GNAI1)
   04916 Melanogenesis
    100172679 (GNAI1)
   04924 Renin secretion
    100172679 (GNAI1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100172679 (GNAI1)
  09154 Digestive system
   04971 Gastric acid secretion
    100172679 (GNAI1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100172679 (GNAI1)
   04727 GABAergic synapse
    100172679 (GNAI1)
   04725 Cholinergic synapse
    100172679 (GNAI1)
   04728 Dopaminergic synapse
    100172679 (GNAI1)
   04726 Serotonergic synapse
    100172679 (GNAI1)
   04730 Long-term depression
    100172679 (GNAI1)
   04723 Retrograde endocannabinoid signaling
    100172679 (GNAI1)
  09158 Development and regeneration
   04360 Axon guidance
    100172679 (GNAI1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100172679 (GNAI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100172679 (GNAI1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100172679 (GNAI1)
  09165 Substance dependence
   05030 Cocaine addiction
    100172679 (GNAI1)
   05032 Morphine addiction
    100172679 (GNAI1)
   05034 Alcoholism
    100172679 (GNAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100172679 (GNAI1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100172679 (GNAI1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100172679 (GNAI1)
   05163 Human cytomegalovirus infection
    100172679 (GNAI1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100172679 (GNAI1)
   05142 Chagas disease
    100172679 (GNAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100172679 (GNAI1)
   04031 GTP-binding proteins [BR:pon04031]
    100172679 (GNAI1)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100172679 (GNAI1)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    100172679 (GNAI1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 AAA_16 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 100172679
NCBI-ProteinID: NP_001125754
Ensembl: ENSPPYG00000017864
UniProt: Q5RAD4
LinkDB
Position
7
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSTCNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgctgagcgccgaggacaaggcggcggtggagcggagtaagatgatcgac
cgcaacctccgcgaggacggcgagaaggcggcgcgcgaggtcaagctgctgctgctgggc
gctggtgaatctggtaaaagtacaattgtgaagcagatgaaaattatccatgaagctggt
tattcagaagaggagtgtaaacaatacaaagcagtggtctacagtaacaccatccagtca
attattgctatcattagggctatggggaggttgaagatagactttggtgactcagcccgg
gcggatgatgcacgccaactctttgtgctagctggagctgctgaagaaggctttatgact
gcagaacttgctggagttataaagagattgtggaaagatagtggtgtacaagcctgtttc
aacagatcccgagagtaccagcttaatgattctgcagcatactatttgaatgacttggac
agaatagctcaaccaaattacatcccgactcaacaagatgttctcagaactagagtgaaa
actacaggaattgttgaaacccattttactttcaaagatcttcattttaaaatgtttgat
gtgggaggtcagagatctgagcggaagaagtggattcattgcttcgaaggagtgacggcg
atcatcttctgtgtagcactgagtgactacgacctggttctagctgaagatgaagaaatg
aatcgaatgcatgaaagcatgaagttgtttgacagcacatgtaacaacaagtggtttaca
gatacatccattatactttttctaaacaagaaggatctctttgaagaaaaaatcaaaaag
agccctctcactatatgctatccagaatatgcaggatcaaacacatatgaagaggcagct
gcatatattcaatgtcagtttgaagacctcaataaaagaaaggacacaaaggaaatatac
acccacttcacatgtgccacagatactaagaatgtgcagtttgtttttgatgctgtaacg
gatgtcatcataaaaaataatctaaaagattgtggtctcttttaa

KEGG   Pongo abelii (Sumatran orangutan): 100456074
Entry
100456074         CDS       T01416                                 

Gene name
GNAI3
Definition
(RefSeq) guanine nucleotide-binding protein G(k) subunit alpha
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04071  Sphingolipid signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04360  Axon guidance
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04670  Leukocyte transendothelial migration
pon04713  Circadian entrainment
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04730  Long-term depression
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04921  Oxytocin signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04924  Renin secretion
pon04926  Relaxin signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04971  Gastric acid secretion
pon05012  Parkinson disease
pon05030  Cocaine addiction
pon05032  Morphine addiction
pon05034  Alcoholism
pon05133  Pertussis
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05163  Human cytomegalovirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100456074 (GNAI3)
   04371 Apelin signaling pathway
    100456074 (GNAI3)
   04071 Sphingolipid signaling pathway
    100456074 (GNAI3)
   04024 cAMP signaling pathway
    100456074 (GNAI3)
   04022 cGMP-PKG signaling pathway
    100456074 (GNAI3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100456074 (GNAI3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100456074 (GNAI3)
   04670 Leukocyte transendothelial migration
    100456074 (GNAI3)
   04062 Chemokine signaling pathway
    100456074 (GNAI3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100456074 (GNAI3)
   04915 Estrogen signaling pathway
    100456074 (GNAI3)
   04914 Progesterone-mediated oocyte maturation
    100456074 (GNAI3)
   04921 Oxytocin signaling pathway
    100456074 (GNAI3)
   04926 Relaxin signaling pathway
    100456074 (GNAI3)
   04935 Growth hormone synthesis, secretion and action
    100456074 (GNAI3)
   04928 Parathyroid hormone synthesis, secretion and action
    100456074 (GNAI3)
   04916 Melanogenesis
    100456074 (GNAI3)
   04924 Renin secretion
    100456074 (GNAI3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100456074 (GNAI3)
  09154 Digestive system
   04971 Gastric acid secretion
    100456074 (GNAI3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100456074 (GNAI3)
   04727 GABAergic synapse
    100456074 (GNAI3)
   04725 Cholinergic synapse
    100456074 (GNAI3)
   04728 Dopaminergic synapse
    100456074 (GNAI3)
   04726 Serotonergic synapse
    100456074 (GNAI3)
   04730 Long-term depression
    100456074 (GNAI3)
   04723 Retrograde endocannabinoid signaling
    100456074 (GNAI3)
  09158 Development and regeneration
   04360 Axon guidance
    100456074 (GNAI3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100456074 (GNAI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100456074 (GNAI3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100456074 (GNAI3)
  09165 Substance dependence
   05030 Cocaine addiction
    100456074 (GNAI3)
   05032 Morphine addiction
    100456074 (GNAI3)
   05034 Alcoholism
    100456074 (GNAI3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100456074 (GNAI3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100456074 (GNAI3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100456074 (GNAI3)
   05163 Human cytomegalovirus infection
    100456074 (GNAI3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100456074 (GNAI3)
   05142 Chagas disease
    100456074 (GNAI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100456074 (GNAI3)
   04031 GTP-binding proteins [BR:pon04031]
    100456074 (GNAI3)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100456074 (GNAI3)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    100456074 (GNAI3)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 100456074
NCBI-ProteinID: XP_002810535
Ensembl: ENSPPYG00000001069
UniProt: H2N6H9 A0A663DCK8
LinkDB
Position
1
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
PELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaagacaaggcggcagtggagcgaagcaagatgatagac
cgcaacttacgggaggacggggaaaaagcggccaaagaagtgaagctgctgctactcggt
gctggagaatctggtaaaagcaccattgtgaaacagatgaaaatcattcatgaggatggc
tattcagaggatgaatgtaaacagtataaagtagttgtctacagcaatactatacagtcc
atcattgcaatcataagagccatgggacggctaaagattgactttggggaagctgccagg
gcagatgatgcccggcaattatttgttttagctggcagtgctgaagaaggagtcatgact
ccagaactagcaggagtgattaaacggttatggcgagatggtggggtacaagcttgcttc
agcagatccagggaatatcagctcaatgattctgcttcatattatctaaatgatctggat
agaatatcccagtctaactacattccaactcagcaagatgttcttcggacgagagtgaag
accacaggcattgtagaaacacatttcaccttcaaagacctatacttcaagatgtttgat
gtaggtggccaaagatcagaacgaaaaaagtggattcactgttttgagggagtgacagca
attatcttctgtgtggccctcagtgattatgaccttgttctggctgaggacgaggagatg
aaccgaatgcatgaaagcatgaaactgtttgacagcatttgtaataacaaatggtttaca
gaaacttcaatcattctcttccttaacaagaaagacctttttgaggaaaaaataaagagg
agtccgttaactatctgttatccagaatacacaggttccaatacatatgaagaggcagct
gcctatattcagtgccagtttgaagatctgaacagaagaaaagataccaaggagatctat
actcacttcacctgtgccacagacacgaagaatgtacagtttgtttttgatgctgttaca
gatgtcatcattaaaaacaacttaaaggaatgtggactttattga

KEGG   Pongo abelii (Sumatran orangutan): 100458137
Entry
100458137         CDS       T01416                                 

Gene name
GNAI2
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-2 isoform X1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04071  Sphingolipid signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04360  Axon guidance
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04670  Leukocyte transendothelial migration
pon04713  Circadian entrainment
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04730  Long-term depression
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04921  Oxytocin signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04924  Renin secretion
pon04926  Relaxin signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04971  Gastric acid secretion
pon05012  Parkinson disease
pon05030  Cocaine addiction
pon05032  Morphine addiction
pon05034  Alcoholism
pon05133  Pertussis
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05163  Human cytomegalovirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100458137 (GNAI2)
   04371 Apelin signaling pathway
    100458137 (GNAI2)
   04071 Sphingolipid signaling pathway
    100458137 (GNAI2)
   04024 cAMP signaling pathway
    100458137 (GNAI2)
   04022 cGMP-PKG signaling pathway
    100458137 (GNAI2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100458137 (GNAI2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100458137 (GNAI2)
   04670 Leukocyte transendothelial migration
    100458137 (GNAI2)
   04062 Chemokine signaling pathway
    100458137 (GNAI2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100458137 (GNAI2)
   04915 Estrogen signaling pathway
    100458137 (GNAI2)
   04914 Progesterone-mediated oocyte maturation
    100458137 (GNAI2)
   04921 Oxytocin signaling pathway
    100458137 (GNAI2)
   04926 Relaxin signaling pathway
    100458137 (GNAI2)
   04935 Growth hormone synthesis, secretion and action
    100458137 (GNAI2)
   04928 Parathyroid hormone synthesis, secretion and action
    100458137 (GNAI2)
   04916 Melanogenesis
    100458137 (GNAI2)
   04924 Renin secretion
    100458137 (GNAI2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100458137 (GNAI2)
  09154 Digestive system
   04971 Gastric acid secretion
    100458137 (GNAI2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100458137 (GNAI2)
   04727 GABAergic synapse
    100458137 (GNAI2)
   04725 Cholinergic synapse
    100458137 (GNAI2)
   04728 Dopaminergic synapse
    100458137 (GNAI2)
   04726 Serotonergic synapse
    100458137 (GNAI2)
   04730 Long-term depression
    100458137 (GNAI2)
   04723 Retrograde endocannabinoid signaling
    100458137 (GNAI2)
  09158 Development and regeneration
   04360 Axon guidance
    100458137 (GNAI2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100458137 (GNAI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100458137 (GNAI2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100458137 (GNAI2)
  09165 Substance dependence
   05030 Cocaine addiction
    100458137 (GNAI2)
   05032 Morphine addiction
    100458137 (GNAI2)
   05034 Alcoholism
    100458137 (GNAI2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100458137 (GNAI2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100458137 (GNAI2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100458137 (GNAI2)
   05163 Human cytomegalovirus infection
    100458137 (GNAI2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100458137 (GNAI2)
   05142 Chagas disease
    100458137 (GNAI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100458137 (GNAI2)
   04031 GTP-binding proteins [BR:pon04031]
    100458137 (GNAI2)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100458137 (GNAI2)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    100458137 (GNAI2)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_16 AAA_29
Other DBs
NCBI-GeneID: 100458137
NCBI-ProteinID: XP_024100513
Ensembl: ENSPPYG00000013851
LinkDB
Position
3
AA seq 355 aa
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL
PDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgggctgcaccgtgagcgccgaggacaaggcggcggccgagcgctctaagatgatcgac
aagaacctgcgggaggacggagagaaggcggcgcgggaggtgaagttgctgctgttgggt
gctggagagtcagggaagagcaccatcgtcaagcagatgaagatcatccacgaggatggc
tactctgaggaggaatgccggcagtaccgggcggttgtctacagcaacaccatccagtcc
atcatggccattgtcaaagccatgggcaacctgcagatcgactttgctgacccctccaga
gcggacgacgccaggcagctatttgcactgtcctgcaccgccgaggagcaaggcgtgctc
cctgatgacctgtccggcgtcatccggaggctctgggctgaccatggtgtgcaggcctgc
tttggccgctcaagggaataccagctcaacgactcagctgcctactacctgaacgacctg
gagcgcattgcacagagtgactacatccccacacagcaagatgtgctacggacccgcgta
aagaccacggggatcgtggagacacacttcaccttcaaggacctacacttcaagatgttt
gatgtgggtggtcagcggtctgagcggaagaagtggatccactgctttgagggcgtcaca
gccatcatcttctgtgtagccttgagcgcctatgacttggtgctagctgaggacgaggag
atgaaccgcatgcatgagagcatgaagctatttgacagcatctgcaacaacaagtggttc
acagacacgtccatcatcctcttcctcaacaagaaggacctgttcgaggagaagatcaca
cacagtcccctgaccatctgcttccctgagtacacaggggccaacaagtatgatgaggca
gccagctacatccagagtaagtttgaggacctgaataagcgcaaagacaccaaggagatc
tacacgcacttcacgtgtgccaccgacaccaagaacgtgcagttcgtgtttgacgccgtc
accgacgtcatcatcaagaacaacctgaaggactgcggcctcttctga

DBGET integrated database retrieval system