KEGG   Pongo abelii (Sumatran orangutan): 100172711
Entry
100172711         CDS       T01416                                 

Gene name
HSPA8
Definition
(RefSeq) heat shock cognate 71 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03040  Spliceosome
pon04010  MAPK signaling pathway
pon04141  Protein processing in endoplasmic reticulum
pon04144  Endocytosis
pon04213  Longevity regulating pathway - multiple species
pon04612  Antigen processing and presentation
pon04915  Estrogen signaling pathway
pon05020  Prion disease
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05162  Measles
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100172711 (HSPA8)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100172711 (HSPA8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100172711 (HSPA8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100172711 (HSPA8)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100172711 (HSPA8)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100172711 (HSPA8)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100172711 (HSPA8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    100172711 (HSPA8)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100172711 (HSPA8)
  09172 Infectious disease: viral
   05162 Measles
    100172711 (HSPA8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100172711 (HSPA8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100172711 (HSPA8)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pon03041]
    100172711 (HSPA8)
   03009 Ribosome biogenesis [BR:pon03009]
    100172711 (HSPA8)
   03110 Chaperones and folding catalysts [BR:pon03110]
    100172711 (HSPA8)
   04131 Membrane trafficking [BR:pon04131]
    100172711 (HSPA8)
   03051 Proteasome [BR:pon03051]
    100172711 (HSPA8)
   03029 Mitochondrial biogenesis [BR:pon03029]
    100172711 (HSPA8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100172711 (HSPA8)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100172711 (HSPA8)
Spliceosome [BR:pon03041]
 Complex B
  Other components
   Prp19 complex
    100172711 (HSPA8)
 Complex C
   Prp19-CDC5 complex
    100172711 (HSPA8)
Ribosome biogenesis [BR:pon03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100172711 (HSPA8)
Chaperones and folding catalysts [BR:pon03110]
 Heat shock proteins
  HSP70 / DNAK
   100172711 (HSPA8)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100172711 (HSPA8)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100172711 (HSPA8)
Proteasome [BR:pon03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100172711 (HSPA8)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100172711 (HSPA8)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100172711 (HSPA8)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR HORMA MetOD2
Other DBs
NCBI-GeneID: 100172711
NCBI-ProteinID: NP_001125783
Ensembl: ENSPPYG00000003987
UniProt: A0A6D2WZ31 Q5RA83
LinkDB
Position
11
AA seq 646 aa
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgtccaagggacctgcagttggtattgatcttggcaccacctactcttgtgtgggtgtt
ttccagcacggaaaagtcgagataattgccaatgatcagggaaaccgaaccactccaagc
tatgtcgcctttacggacactgaacggttgatcggtgatgccgcaaagaatcaagttgca
atgaaccccaccaacacagtttttgatgccaaacgtttgattggacgcagatttgatgat
gctgttgtccagtctgatatgaaacattggcccttcatggtggtgaatgatgctggcagg
cccaaggtccaagtagaatacaagggagagaccaaaagcttctatccagaggaggtatcc
tctatggttctgacaaagatgaaggaaattgcagaagcctaccttgggaagactgttacc
aatgctgtggtcacagtgccagcttactttaatgactctcagcgtcaggccaccaaagat
gctggaactattgctggtctcaatgtacttagaattattaatgagccaactgctgctgct
attgcttacggcttagacaaaaaggttggagcagaaagaaacgtgctcatctttgacctg
ggaggtggcacttttgatgtgtcaatcctcactattgaggatggaatctttgaggtcaag
tctacagctggagacacccacttgggtggagaagattttgacaaccgaatggtcaaccat
tttattgctgagtttaagcgcaagcataagaaggacatcagtgagaacaagagagctgta
agacgtctccgtactgcttgtgaacgtgctaagcgtaccctctcttccagcacccaggcc
agtattgagatcgattctctctatgaaggaatcgacttctatacctccattacccgtgcc
cgatttgaagaattgaatgctgacctgttccgtggcaccctggacccagtagagaaagcc
cttcgagatgccaaattggacaagtcacagattcatgatattgtcctggttggtggttct
actcgtatccccaagattcagaagcttctccaagactttttcaatggaaaagaactgaat
aagagcatcaaccctgatgaagctgttgcttatggtgcagctgtccaggcagccatcttg
tctggagacaagtctgagaatgttcaggatttgctgctcttggatgtcactcctctttcc
cttggtattgaaactgctggtggagtcatgaccgtcctcatcaagcgtaataccaccatt
cctaccaagcagacgcagaccttcactacctattctgacaaccagcctggtgtgcttatt
caggtttatgaaggcgagcgtgccatgaccaaggataacaacctgcttggcaagtttgaa
ctcacgggcatacctcctgcaccccgaggtgttcctcagattgaagtcacttttgacatt
gatgccaatggtatcctcaatgtctctgctgtggacaagagtacaggaaaagagaataag
attactatcactaatgacaagggccgtttgagcaaggaagacattgaacgtatggtccag
gaagctgagaagtacaaagctgaagatgagaagcagagggacaaggtgtcatccaagaat
tcacttgagtcctatgccttcaacatgaaagcaactgttgaagatgagaaacttcaaggc
aagattaacgatgaggacaaacagaagattctggacaagtgtaatgaaattatcaactgg
cttgataagaatcagactgctgagaaggaggaatttgaacatcaacagaaagagctggag
aaagtttgcaaccccatcatcaccaagctgtaccagagtgcaggaggcatgccaggagga
atgcctgggggattccctggtggtggagctcctccctctggtggtgcttcctcggggccc
accattgaagaggttgattaa

KEGG   Pongo abelii (Sumatran orangutan): 100172826
Entry
100172826         CDS       T01416                                 

Gene name
HSPA1A
Definition
(RefSeq) heat shock 70 kDa protein 1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03040  Spliceosome
pon04010  MAPK signaling pathway
pon04141  Protein processing in endoplasmic reticulum
pon04144  Endocytosis
pon04213  Longevity regulating pathway - multiple species
pon04612  Antigen processing and presentation
pon04915  Estrogen signaling pathway
pon05020  Prion disease
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05162  Measles
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100172826 (HSPA1A)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100172826 (HSPA1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100172826 (HSPA1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100172826 (HSPA1A)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100172826 (HSPA1A)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100172826 (HSPA1A)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100172826 (HSPA1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    100172826 (HSPA1A)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100172826 (HSPA1A)
  09172 Infectious disease: viral
   05162 Measles
    100172826 (HSPA1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100172826 (HSPA1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100172826 (HSPA1A)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pon03041]
    100172826 (HSPA1A)
   03009 Ribosome biogenesis [BR:pon03009]
    100172826 (HSPA1A)
   03110 Chaperones and folding catalysts [BR:pon03110]
    100172826 (HSPA1A)
   04131 Membrane trafficking [BR:pon04131]
    100172826 (HSPA1A)
   03051 Proteasome [BR:pon03051]
    100172826 (HSPA1A)
   03029 Mitochondrial biogenesis [BR:pon03029]
    100172826 (HSPA1A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100172826 (HSPA1A)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100172826 (HSPA1A)
Spliceosome [BR:pon03041]
 Complex B
  Other components
   Prp19 complex
    100172826 (HSPA1A)
 Complex C
   Prp19-CDC5 complex
    100172826 (HSPA1A)
Ribosome biogenesis [BR:pon03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100172826 (HSPA1A)
Chaperones and folding catalysts [BR:pon03110]
 Heat shock proteins
  HSP70 / DNAK
   100172826 (HSPA1A)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100172826 (HSPA1A)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100172826 (HSPA1A)
Proteasome [BR:pon03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100172826 (HSPA1A)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100172826 (HSPA1A)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100172826 (HSPA1A)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR Hydantoinase_A Radial_spoke_3
Other DBs
NCBI-GeneID: 100172826
NCBI-ProteinID: NP_001125893
Ensembl: ENSPPYG00000016463
UniProt: Q5R7D3
LinkDB
Position
6
AA seq 641 aa
MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVNNDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFEPSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN
ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE
QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggccaaagccgcggcgatcggcatcgacctgggcaccacctactcctgcgtgggggtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccccagc
tacgtggccttcacggacaccgagcggctcatcggggatgcggccaagaaccaggtggcg
ctgaacccgcagaacaccgtgtttgacgcgaagcggctgatcggccgcaagttcggcgac
ccggtggtgcagtcggacatgaagcactggcctttccaggtgaacaacgacggagacaag
cccaaggtgcaggtgagctacaagggggagaccaaggcattctaccctgaggagatctcg
tccatggtgctgaccaagatgaaggagatcgccgaggcgtacctgggctacccggtgacc
aacgcggtgatcaccgtgccggcctacttcaacgactcgcagcgccaggccaccaaggat
gcgggtgtgatcgcgggactcaacgtgctgcggatcatcaacgagcccacggccgccgcc
atcgcctacggcctagacagaacgggcaagggggagcgcaacgtgctcatctttgacctg
ggcgggggcaccttcgacgtgtccatcctgacgatcgacgacggcatcttcgaggtgaag
gccacggccggggacacccacctgggtggggaggactttgacaacaggctggtgaaccac
ttcgtggaggagttcaagagaaaacacaagaaggacatcagccagaacaagcgagccgtg
aggcggctgcgcaccgcctgcgagagggccaagaggaccctgtcgtccagcacccaggcc
agcctggagatcgactccctgtttgagggcatcgacttctacacgtccatcaccagggcg
aggttcgaggagctgtgctcggacctgttccgaagcaccctggagcccgtggagaaggct
ctgcgcgacgccaagctggacaaggcccagatccacgacctggtcctggtcgggggctcc
acccgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctgaac
aagagcatcaaccccgacgaggctgtggcctacggggcggcggtgcaggcggccatcctg
atgggggacaagtccgagaacgtgcaggacctgctgctgctggatgtggctcccctgtcg
ctggggctggagacggccggaggcgtgatgactgccctgatcaagcgcaactccaccatc
cccaccaagcagacgcagatcttcaccacctactccgacaaccaacccggggtgctgatc
caggtgtacgagggcgagagggccatgacgaaggacaacaatctgttggggcgcttcgag
ccgagcggcatccctccggcccccaggggcgtgcctcagatcgaggtgaccttcgacatc
gatgccaacggcatcctgaacgtcacggccacggacaagagcaccggcaaggccaacaag
atcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcag
gaggcggagaagtacaaagcggaggacgaggtgcagcgcgagagggtgtcagccaagaac
gccttggagtcctacgccttcaacatgaagagcgccgtggaggatgaagggctcaagggc
aagatcagcgaggccgacaagaagaaggtgctggacaagtgtcaagaggtcatctcgtgg
ctggacgccaacaccctggccgagaaggacgagtttgagcacaagaggaaggagctggag
caggtgtgtaaccccatcatcagcggactgtaccagggtgcgggtggtcccgggcctggc
ggcttcggggctcagggccccaagggagggtctgggtcaggccccaccattgaggaggta
gattag

KEGG   Pongo abelii (Sumatran orangutan): 100454739
Entry
100454739         CDS       T01416                                 

Gene name
HSPA6
Definition
(RefSeq) heat shock 70 kDa protein 6
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03040  Spliceosome
pon04010  MAPK signaling pathway
pon04141  Protein processing in endoplasmic reticulum
pon04144  Endocytosis
pon04213  Longevity regulating pathway - multiple species
pon04612  Antigen processing and presentation
pon04915  Estrogen signaling pathway
pon05020  Prion disease
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05162  Measles
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100454739 (HSPA6)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100454739 (HSPA6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100454739 (HSPA6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100454739 (HSPA6)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100454739 (HSPA6)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100454739 (HSPA6)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100454739 (HSPA6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    100454739 (HSPA6)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100454739 (HSPA6)
  09172 Infectious disease: viral
   05162 Measles
    100454739 (HSPA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100454739 (HSPA6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100454739 (HSPA6)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pon03041]
    100454739 (HSPA6)
   03009 Ribosome biogenesis [BR:pon03009]
    100454739 (HSPA6)
   03110 Chaperones and folding catalysts [BR:pon03110]
    100454739 (HSPA6)
   04131 Membrane trafficking [BR:pon04131]
    100454739 (HSPA6)
   03051 Proteasome [BR:pon03051]
    100454739 (HSPA6)
   03029 Mitochondrial biogenesis [BR:pon03029]
    100454739 (HSPA6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100454739 (HSPA6)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100454739 (HSPA6)
Spliceosome [BR:pon03041]
 Complex B
  Other components
   Prp19 complex
    100454739 (HSPA6)
 Complex C
   Prp19-CDC5 complex
    100454739 (HSPA6)
Ribosome biogenesis [BR:pon03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100454739 (HSPA6)
Chaperones and folding catalysts [BR:pon03110]
 Heat shock proteins
  HSP70 / DNAK
   100454739 (HSPA6)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100454739 (HSPA6)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100454739 (HSPA6)
Proteasome [BR:pon03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100454739 (HSPA6)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100454739 (HSPA6)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100454739 (HSPA6)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A DUF1464 DNApol_Exo
Other DBs
NCBI-GeneID: 100454739
NCBI-ProteinID: XP_002809930
Ensembl: ENSPPYG00000000595
UniProt: H2N503 A0A663D9Z9
LinkDB
Position
1
AA seq 643 aa
MQAPRELAVGIDLGTTYSCVGVFQQSRVEILANDQGNRTTPSYVAFTDTERLVGDSAKSQ
AALNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFQVVSEGGKPKVRVSYRGEDKTFYPEE
ISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA
AAIAYGLDRRGAGERNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLV
NHFMEEFRRKHGKDLSGNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSIT
RARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKVQKLLQDFFNGKE
LNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNA
TIPTKQTQTFTTYSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTF
DIDANGILSVTATDRSTGKANKITITNDKGRLSKEEVERMVREAEQYKAEDEAQRDRVAA
KNSLEAHVFHVKGSLQEESLRDKIPEEDRRKVQDKCQEVLAWLEHNQLAEKEEYEHQKRE
LEQICCPIFSRLYGGPGVPGSSSCGAQARQGDPSTGPIIEEVD
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgcaggccccacgggagctcgcggtgggcatcgacctgggcaccacctactcgtgcgtg
ggcgtgtttcagcagagccgcgtggagatcctggccaacgaccagggcaaccgcaccacg
cccagctacgtggccttcaccgacaccgagcggctggtcggggactcggccaagagccag
gcggccctgaacccccacaacaccgtgttcgatgccaagcggctgatcgggcgcaagttc
gcggacaccacggtgcagtcggacatgaagcactggcccttccaggtggtgagcgagggc
ggcaagcccaaggtgcgcgtgtcctaccgcggggaggacaagacgttctaccccgaggag
atctcgtccatggtgctgagcaagatgaaggagacggccgaggcgtacctgggccagccc
gtgaagcacgcagtgatcaccgtgcccgcctatttcaatgactcgcagcgccaggccacc
aaggacgcgggggccatcgcggggctcaacgtgctgcggatcatcaatgagcccacggca
gcagccatcgcctatgggctggaccggcggggcgcgggagagcgcaacgtgctcattttt
gacctaggtgggggcaccttcgatgtgtcggttctctccattgacgccggtgtctttgag
gtgaaagccactgctggagatacccacctgggaggagaggacttcgacaaccggctggtg
aaccacttcatggaagaattccggcggaagcatgggaaggacctgagcgggaacaagcgc
gccctgcgcaggctgcgcacagcctgtgagcgcgccaagcgcaccctgtcctccagcacc
caggccaccctggagatagactccctgttcgagggcgtggacttctacacgtccatcact
cgtgcccgctttgaggaactgtgctcagacctcttccgtagcaccctggagccggtggag
aaggccctgcgggatgccaagctggacaaggcccagattcatgacgtcgtcctggtgggg
ggttccactcgcatccccaaggtgcagaagttgctgcaggacttcttcaacggcaaggag
ctgaacaagagcatcaaccctgatgaggctgtggcctatggggctgctgtgcaggcggcc
gtgttgatgggggacaagtgtgagaaagtgcaggatctcctgctgctggatgtggctccc
ctgtctctggggctggagacagcaggtggggtgatgaccacgctgatccagaggaacgcc
actatccccaccaagcagacccagactttcaccacctactcggacaaccagcctggggtc
ttcatccaggtgtatgagggtgagagggccatgaccaaggacaacaacctgctggggcgt
tttgaactcagtggcatccctcctgccccacgtggagtcccccagatagaggtgaccttt
gacattgatgctaatggcatcctgagcgtgacagccactgacaggagcacaggtaaggct
aacaagatcaccatcaccaatgacaagggccggctgagcaaggaggaggtggagaggatg
gttcgtgaagccgagcagtacaaggctgaggatgaggcccagagggacagagtggctgcc
aaaaactcgctggaggcccatgtcttccatgtgaaaggttctttgcaagaggaaagcctt
agggacaagattcccgaggaggacaggcgcaaagtgcaagacaagtgtcaggaagtcctt
gcctggctggagcacaaccagctggcagagaaggaggagtatgagcatcagaagagggag
ctggagcaaatctgttgccccatcttctccaggctctatggggggcctggtgtccctggg
agcagcagttgtggcgctcaagcccgccagggggaccccagcaccggccccatcattgag
gaggttgattga

KEGG   Pongo abelii (Sumatran orangutan): 100458051
Entry
100458051         CDS       T01416                                 

Definition
(RefSeq) heat shock 70 kDa protein 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03040  Spliceosome
pon04010  MAPK signaling pathway
pon04141  Protein processing in endoplasmic reticulum
pon04144  Endocytosis
pon04213  Longevity regulating pathway - multiple species
pon04612  Antigen processing and presentation
pon04915  Estrogen signaling pathway
pon05020  Prion disease
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05162  Measles
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100458051
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100458051
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100458051
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100458051
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100458051
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100458051
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100458051
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    100458051
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100458051
  09172 Infectious disease: viral
   05162 Measles
    100458051
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100458051
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100458051
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pon03041]
    100458051
   03009 Ribosome biogenesis [BR:pon03009]
    100458051
   03110 Chaperones and folding catalysts [BR:pon03110]
    100458051
   04131 Membrane trafficking [BR:pon04131]
    100458051
   03051 Proteasome [BR:pon03051]
    100458051
   03029 Mitochondrial biogenesis [BR:pon03029]
    100458051
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100458051
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100458051
Spliceosome [BR:pon03041]
 Complex B
  Other components
   Prp19 complex
    100458051
 Complex C
   Prp19-CDC5 complex
    100458051
Ribosome biogenesis [BR:pon03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100458051
Chaperones and folding catalysts [BR:pon03110]
 Heat shock proteins
  HSP70 / DNAK
   100458051
Membrane trafficking [BR:pon04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100458051
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100458051
Proteasome [BR:pon03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100458051
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100458051
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100458051
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3
Other DBs
NCBI-GeneID: 100458051
NCBI-ProteinID: XP_002816711
Ensembl: ENSPPYG00000016462
UniProt: A0A6D2WIJ5 H2PIK6
LinkDB
Position
6
AA seq 641 aa
MTTAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEGGKPKVLVSYKGENKAFYPEE
ISSMVLTKMKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSIT
RARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDYFNGRD
LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTF
DIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAA
KNALESYAFNMKSVVSDEGLKGKISESDKKKILDKCNELLSWLEANQLAEKDEFDHKRKE
LEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgactactgccaagggaatcgccataggcatcgacctgggcaccacctactcctgcgtg
ggagtgttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacc
cccagctacgtggccttcacggacaccgagcggctcatcggggatgcggccaagaaccag
gtagccatgaatccccagaacactgtttttgatgctaaacgtctgatcggcaggaaattt
aatgatcctgttgtacaatcagatatgaaactttggccttttcaagtgattaatgaagga
ggcaagcccaaagtccttgtgtcctacaaaggggagaataaagctttctaccctgaggaa
atctcttcgatggtactgactaagatgaaggagactgctgaggcttttttgggccaccct
gtcaccaatgcagtgattaccgtgccagcctatttcaatgactctcaacgtcaggctact
aaggatgcaggtgtgattgctggacttaatgtgctaagaatcatcaatgagcccacagct
gctgccattgcctatggtttagataaaggaggtcaaggagaacgacatgtcctgattttt
gatctgggtggaggcacatttgatgtgtcaattctgaccatagatgatgggatttttgag
gtaaaggccactgctggggacactcacctgggtggggaggactttgacaacaggcttgtg
agccacttcgtggaggagttcaagagaaagcacaaaaaggacatcagccagaacaagcga
gctgtgaggcggctgcgcaccgcctgcgagagggccaagaggaccctgtcgtccagcacc
caggccaacctagaaattgattcactttatgaaggcattgacttctacacatccatcacc
agagctcgatttgaagagttgtgtgcagacctgtttaggggtaccctggagcctgtagaa
aaagcgcttcgggatgccaagatggataaggctaaaatccatgacattgttttagtaggg
ggctccacccgcatccccaaggtgcagcggctgcttcaggactactttaatggacgtgat
ctcaacaaaagcatcaaccctgatgaggccgtagcatatggggctgcggtacaggcagcc
atcctgatgggggacaagtctgagaaggtacaggacctgctgctgctggatgtggctccc
ctgtcactggggctggagacggctgggggcgtgatgactgccctgatcaagcgcaactcc
accatccccaccaagcagacacagattttcaccacctactctgacaaccaacccggggtg
ctgatccaggtatatgagggcgagagggccatgacaaaggacaacaacctgctggggcgg
tttgacctgactggaatccctccagcacccaggggagttcctcagatcgaggtgacgttt
gacattgatgccaatggtattctcaatgtcacagccatggacaagagcactggcaaggcc
aacaagatcaccatcaccaatgacaagggccgcctgagcaaggaggagattgagcgcatg
gttctggatgctgagaaatataaagctgaagatgaggtccagagggagaaaattgctgca
aagaatgccttagaatcctatgcttttaacatgaagagtgttgtgagtgatgaaggtttg
aagggcaagattagtgagtctgataaaaagaaaatactggataaatgcaacgagctcctt
tcgtggctggaggccaatcaactggcagagaaagatgagtttgatcataagagaaaggaa
ttggagcagatgtgtaaccccatcatcacaaaactctaccaaggaggatgcactgggcct
gcctgtggaacagggtatgtgcctggaaggcctgccacaggccccactattgaagaagta
gattaa

KEGG   Pongo abelii (Sumatran orangutan): 100461792
Entry
100461792         CDS       T01416                                 

Gene name
HSPA2
Definition
(RefSeq) heat shock-related 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03040  Spliceosome
pon04010  MAPK signaling pathway
pon04141  Protein processing in endoplasmic reticulum
pon04144  Endocytosis
pon04213  Longevity regulating pathway - multiple species
pon04612  Antigen processing and presentation
pon04915  Estrogen signaling pathway
pon05020  Prion disease
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05162  Measles
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100461792 (HSPA2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100461792 (HSPA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100461792 (HSPA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100461792 (HSPA2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100461792 (HSPA2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100461792 (HSPA2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100461792 (HSPA2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    100461792 (HSPA2)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100461792 (HSPA2)
  09172 Infectious disease: viral
   05162 Measles
    100461792 (HSPA2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100461792 (HSPA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100461792 (HSPA2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pon03041]
    100461792 (HSPA2)
   03009 Ribosome biogenesis [BR:pon03009]
    100461792 (HSPA2)
   03110 Chaperones and folding catalysts [BR:pon03110]
    100461792 (HSPA2)
   04131 Membrane trafficking [BR:pon04131]
    100461792 (HSPA2)
   03051 Proteasome [BR:pon03051]
    100461792 (HSPA2)
   03029 Mitochondrial biogenesis [BR:pon03029]
    100461792 (HSPA2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100461792 (HSPA2)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100461792 (HSPA2)
Spliceosome [BR:pon03041]
 Complex B
  Other components
   Prp19 complex
    100461792 (HSPA2)
 Complex C
   Prp19-CDC5 complex
    100461792 (HSPA2)
Ribosome biogenesis [BR:pon03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100461792 (HSPA2)
Chaperones and folding catalysts [BR:pon03110]
 Heat shock proteins
  HSP70 / DNAK
   100461792 (HSPA2)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100461792 (HSPA2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100461792 (HSPA2)
Proteasome [BR:pon03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100461792 (HSPA2)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100461792 (HSPA2)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100461792 (HSPA2)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF1464 Hydantoinase_A DDR CRIC_ras_sig
Other DBs
NCBI-GeneID: 100461792
NCBI-ProteinID: XP_002824887
Ensembl: ENSPPYG00000005902
UniProt: A0A6D2W7E6 A0A2J8WLT7
LinkDB
Position
14
AA seq 639 aa
MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEI
SSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVA
AKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQK
ELERVCNPIISKLYQGGSGGGSGGGGSGASGGPTIEEVD
NT seq 1920 nt   +upstreamnt  +downstreamnt
atgtctgcccgtggcccggctatcggcatcgacctgggcaccacctactcgtgcgtgggt
gtcttccaacatggcaaggtggagatcatcgccaacgaccagggcaaccgcaccaccccc
agctacgtggccttcacggacaccgagcgcctcatcggcgacgccgccaagaaccaggtg
gccatgaaccccaccaacaccatcttcgacgccaagaggctgattggacggaagttcgag
gatgccacagtgcagtcggatatgaaacactggccgttccgggtggtgagcgagggaggc
aagcccaaagtgcaagtggagtacaagggggagaccaagaccttcttcccagaggagata
tcctccatggtcctcacgaagatgaaggagattgcggaagcctacctggggggcaaggtg
cacagcgcggtcataacggtcccggcctatttcaacgactcgcagcgccaggccaccaag
gacgcgggcaccatcacggggctcaatgtgctgcgcatcatcaacgagcccacggcggcg
gccatcgcctacggcctggacaagaagggctgcgcgggcggcgagaagaacgtgctcatc
tttgacctgggcggtggcactttcgacgtgtccatcctgaccatcgaggatggcatcttc
gaggtgaagtccacggccggcgacacccacctgggcggtgaggacttcgacaaccgcatg
gtgagccacctggcggaggagttcaagcgcaagcacaagaaggacattgggcccaacaag
cgcgccgtgaggcggctgcgcaccgcctgcgagcgcgccaagcgcaccctgagctcatcc
acgcaggcgagcatcgagatcgactcgctctacgagggcgttgacttctatacgtccatc
acgcgcgcccgcttcgaggagctcaatgccgacctctttcgcgggaccctggagccagtg
gagaaggcgctgcgcgacgccaagctggacaagggccagatccaggagatcgtgctggtg
ggcggctccactcgtatccccaagatccagaagctgctgcaggatttcttcaacggcaag
gagctgaacaagagcatcaaccccgacgaggcggtggcctatggcgccgcggtgcaggcg
gccatcctcatcggcgacaaatcagagaatgtgcaggacctgctgctactcgacgtgacc
ccgttgtcgctgggcatcgagacagctggcggtgtcatgaccccactcatcaagaggaac
accacgatccccaccaagcagacgcagaccttcaccacctactcggacaaccagagcagc
gtgctggtgcaggtatacgagggcgaacgggccatgaccaaggacaataacctgctgggc
aagttcgacctgaccgggattccccctgcgcctcgcggggtcccccagatcgaggttacc
ttcgacattgacgccaatggcatccttaacgttaccgccgccgacaagagcaccggtaag
gaaaacaaaatcaccatcaccaatgacaaaggtcgtctgagcaaggacgacattgaccgg
atggtgcaggaggcggagcggtacaaatcggaagatgaggcgaatcgcgaccgagtcgcg
gccaaaaacgccctggagtcctatacctacaacatcaagcagacagtggaagacgagaaa
ctgaggggcaagattagcgagcaggacaaaaacaagatcctcgacaagtgtcaggaggtg
atcaactggctcgaccgaaaccagatggcagagaaagatgagtatgaacacaagcagaaa
gagctcgaaagagtttgcaaccccatcatcagcaaactttaccaaggtggttctggcggc
ggcagcggcggcggcggttcaggagcctccgggggacccaccatcgaagaagtggactaa

KEGG   Pongo abelii (Sumatran orangutan): 103890872
Entry
103890872         CDS       T01416                                 

Definition
(RefSeq) heat shock 70 kDa protein 1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03040  Spliceosome
pon04010  MAPK signaling pathway
pon04141  Protein processing in endoplasmic reticulum
pon04144  Endocytosis
pon04213  Longevity regulating pathway - multiple species
pon04612  Antigen processing and presentation
pon04915  Estrogen signaling pathway
pon05020  Prion disease
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05162  Measles
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103890872
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103890872
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103890872
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103890872
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    103890872
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103890872
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    103890872
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    103890872
  09171 Infectious disease: bacterial
   05134 Legionellosis
    103890872
  09172 Infectious disease: viral
   05162 Measles
    103890872
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103890872
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    103890872
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pon03041]
    103890872
   03009 Ribosome biogenesis [BR:pon03009]
    103890872
   03110 Chaperones and folding catalysts [BR:pon03110]
    103890872
   04131 Membrane trafficking [BR:pon04131]
    103890872
   03051 Proteasome [BR:pon03051]
    103890872
   03029 Mitochondrial biogenesis [BR:pon03029]
    103890872
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    103890872
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     103890872
Spliceosome [BR:pon03041]
 Complex B
  Other components
   Prp19 complex
    103890872
 Complex C
   Prp19-CDC5 complex
    103890872
Ribosome biogenesis [BR:pon03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103890872
Chaperones and folding catalysts [BR:pon03110]
 Heat shock proteins
  HSP70 / DNAK
   103890872
Membrane trafficking [BR:pon04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    103890872
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    103890872
Proteasome [BR:pon03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103890872
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    103890872
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   103890872
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR Hydantoinase_A Radial_spoke_3
Other DBs
NCBI-GeneID: 103890872
NCBI-ProteinID: XP_024104850
LinkDB
Position
6
AA seq 641 aa
MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN
ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE
QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggccaaagccgcggcgatcggcatcgacctgggcaccacctactcctgcgtgggggtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccccagc
tacgtggccttcacggacaccgagcggctcatcggggatgcggccaagaaccaggtggcg
ctgaacccgcagaacaccgtgtttgacgcgaagcggctgatcggccgcaagttcggcgac
ccggtggtgcagtcggacatgaagcactggcctttccaggtgatcaacgacggagacaag
cccaaggtgcaggtgagctacaagggggagaccaaggcattctaccctgaggagatctcg
tccatggtgctgaccaagatgaaggagatcgccgaggcgtacctgggctacccggtgacc
aacgcggtgatcaccgtgccggcctacttcaacgactcgcagcgccaggccaccaaggat
gcgggtgtgatcgcggggctcaacgtgctgcggatcatcaacgagcccacggccgccgcc
atcgcctacggcctagacagaacgggcaagggggagcgcaacgtgctcatctttgacctg
ggcgggggcaccttcgacgtgtccatcctgacgatcgacgacggcatcttcgaggtgaag
gccacggccggggacacccacctgggtggggaggactttgacaacaggctggtgaaccac
ttcgtggaggagttcaagagaaaacacaagaaggacatcagccagaacaagcgagccgtg
aggcggctgcgcaccgcctgcgagagggccaagaggaccctgtcgtccagcacccaggcc
agcctggagatcgactccctgtttgagggcatcgacttctacacgtccatcaccagggcg
aggttcgaggagctgtgctcggacctgttccgaagcaccctggagcccgtggagaaggct
ctgcgcgacgccaagctggacaaggcccagatccacgacctggtcctggtcgggggctcc
acccgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctgaac
aagagcatcaaccccgacgaggctgtggcctacggggcggcggtgcaggcggccatcctg
atgggggacaagtccgagaacgtgcaggacctgctgctgctggatgtggctcccctgtcg
ctggggctggagacggccggaggcgtgatgactgccctgatcaagcgcaactccaccatc
cccaccaagcagacgcagatcttcaccacctactccgacaaccaacccggggtgctgatc
caggtgtacgagggcgagagggccatgacgaaggacaacaatctgttggggcgcttcgag
ctgagcggcatccctccggcccccaggggcgtgcctcagatcgaggtgaccttcgacatc
gatgccaacggcatcctgaacgtcacggccacggacaagagcaccggcaaggccaacaag
atcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcag
gaggcggagaagtacaaagcggaggacgaggtgcagcgcgagagggtgtcagccaagaac
gccctggagtcctacgccttcaacatgaagagcgccgtggaggatgaagggctcaagggc
aagatcagcgaggccgacaagaagaaggtgctggacaagtgtcaagaggtcatctcgtgg
ctggacgccaacaccctggccgagaaggacgagtttgagcacaagaggaaggagctggag
caggtgtgtaaccctatcatcagcggactgtaccagggtgcgggtggtcccgggcctggc
ggcttcggggctcagggtcccaagggagggtctgggtcaggccccaccattgaggaggtg
gattag

DBGET integrated database retrieval system