KEGG   Pongo abelii (Sumatran orangutan): 100172718
Entry
100172718         CDS       T01416                                 

Gene name
PDGFD
Definition
(RefSeq) platelet-derived growth factor D precursor
  KO
K05450  platelet derived growth factor C/D
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04540  Gap junction
pon04810  Regulation of actin cytoskeleton
pon05215  Prostate cancer
pon05218  Melanoma
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100172718 (PDGFD)
   04014 Ras signaling pathway
    100172718 (PDGFD)
   04015 Rap1 signaling pathway
    100172718 (PDGFD)
   04020 Calcium signaling pathway
    100172718 (PDGFD)
   04072 Phospholipase D signaling pathway
    100172718 (PDGFD)
   04151 PI3K-Akt signaling pathway
    100172718 (PDGFD)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100172718 (PDGFD)
   04540 Gap junction
    100172718 (PDGFD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100172718 (PDGFD)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100172718 (PDGFD)
  09162 Cancer: specific types
   05218 Melanoma
    100172718 (PDGFD)
   05215 Prostate cancer
    100172718 (PDGFD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100172718 (PDGFD)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100172718 (PDGFD)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 100172718
NCBI-ProteinID: NP_001125790
Ensembl: ENSPPYG00000003821
UniProt: Q5RA73 A0A2J8XX72
LinkDB
Position
11
AA seq 370 aa
MHRLIFVCTLVCANFCSCRDTSATPQSASIKALRNANLRRDESNHLTDLYRRDETIQVRG
NGYVQSPRFPNSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDIS
ETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASE
TNWESVTSSISGVSYNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMY
LDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQ
RCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERC
DCICSSRPPR
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgcaccggctcatctttgtctgcactctagtctgcgcaaacttttgcagctgtcgggac
acttctgcaactccgcagagcgcgtccatcaaagctttgcgcaacgccaacctcaggcga
gatgagagcaatcacctcacagacttgtaccgaagagatgagaccatccaggtgagagga
aacggctacgtgcagagtcctagattcccgaacagctaccccaggaacctgctcctgaca
tggcggcttcactcccaggagaatacacggatacagctagtgtttgacaatcagtttgga
ttagaggaagcagaaaatgatatctgtaggtatgattttgtggaagttgaagatatatcc
gaaaccagtaccattattagaggacgatggtgtggacacaaggaagttcctccaaggata
aaatcaagaacgaaccaaattaaaatcacattcaagtccgatgactactttgtggctaaa
cctggattcaagatttattattctttgctggaagatttccaacccgcagcagcttcagag
accaactgggaatctgtcacaagctctatttcaggggtatcctataactctccatcagta
acggatcccactctgattgcggatgctctggacaaaaaaattgcagaatttgataccgtg
gaagatctgctgaagtacttcaatccagagtcatggcaagaagatcttgagaatatgtat
ttggacacccctcgttatcgaggcaggtcataccatgaccggaagtcaaaagttgacctg
gataggctcaatgatgatgccaagcgttacagttgcactcccaggaattactcggtcaat
ataagagaagagctgaagctggccaatgtggtcttctttccacgttgcctcctcgtgcag
cgctgtggaggaaactgtggctgtggaactgtcaactggaggtcctgcacatgcaattca
gggaaaaccgtgaaaaagtatcatgaggtattacagtttgagcctggccacatcaagagg
aggggcagagctaagaccatggctctggttgacatccagttggatcaccatgaacgatgc
gattgtatctgcagctcaagaccacctcgataa

KEGG   Pongo abelii (Sumatran orangutan): 100172994
Entry
100172994         CDS       T01416                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha precursor
  KO
K08774  transforming growth factor, alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04915  Estrogen signaling pathway
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05223  Non-small cell lung cancer
pon05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100172994 (TGFA)
   04012 ErbB signaling pathway
    100172994 (TGFA)
   04014 Ras signaling pathway
    100172994 (TGFA)
   04151 PI3K-Akt signaling pathway
    100172994 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100172994 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100172994 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100172994 (TGFA)
   05212 Pancreatic cancer
    100172994 (TGFA)
   05225 Hepatocellular carcinoma
    100172994 (TGFA)
   05214 Glioma
    100172994 (TGFA)
   05211 Renal cell carcinoma
    100172994 (TGFA)
   05215 Prostate cancer
    100172994 (TGFA)
   05223 Non-small cell lung cancer
    100172994 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100172994 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 100172994
NCBI-ProteinID: NP_001126045
Ensembl: ENSPPYG00000012322
UniProt: Q5R8W2
LinkDB
Position
2A
AA seq 160 aa
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSTLLKGRTACCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggtcccctcggctggacagctcgccctgttcgcgctgggtattgtgttggccgcgtgc
caggccttggagaacagcacgtccccgctgagcgcagacccgcccgtggccgcagcagtg
gtgtcccattttaatgactgcccagattcccacactcagttctgcttccatggaacctgc
aggtttttggtgcaggaggacaagccagcatgtgtctgccattctgggtacgttggtgca
cgctgtgagcatgcggacctcttggccgtggtggccgccagccagaagaagcaggccatc
accgccttggtggtggtctccatcgtggccctggctgtccttatcatcacatgtgtgctg
atacactgctgccaggtccgaaaacactgtgagtggtgccgggccctcatctgccggcac
gagaagcccagcaccctcctgaagggaagaaccgcttgctgccactcagaaacagtggtc
tga

KEGG   Pongo abelii (Sumatran orangutan): 100437861
Entry
100437861         CDS       T01416                                 

Gene name
PDGFC
Definition
(RefSeq) platelet-derived growth factor C
  KO
K05450  platelet derived growth factor C/D
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04540  Gap junction
pon04810  Regulation of actin cytoskeleton
pon05215  Prostate cancer
pon05218  Melanoma
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100437861 (PDGFC)
   04014 Ras signaling pathway
    100437861 (PDGFC)
   04015 Rap1 signaling pathway
    100437861 (PDGFC)
   04020 Calcium signaling pathway
    100437861 (PDGFC)
   04072 Phospholipase D signaling pathway
    100437861 (PDGFC)
   04151 PI3K-Akt signaling pathway
    100437861 (PDGFC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100437861 (PDGFC)
   04540 Gap junction
    100437861 (PDGFC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100437861 (PDGFC)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100437861 (PDGFC)
  09162 Cancer: specific types
   05218 Melanoma
    100437861 (PDGFC)
   05215 Prostate cancer
    100437861 (PDGFC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100437861 (PDGFC)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100437861 (PDGFC)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 100437861
NCBI-ProteinID: XP_024102123
LinkDB
Position
4
AA seq 345 aa
MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHS
PRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSA
LPLDLLNNAITAFRTLEDLIRYLEPERWQVDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgagcctcttcgggcttctcctgctgacatctgccctggccggccagagacaggggact
caggcggaatccaacctgagcagtaaattccagttctccagcaacaaggaacagaacgga
gtacaagatcctcagcatgagagaattattactgtgtctactaatggaagtattcacagc
ccaaggtttcctcatacttatccaagaaatacggtcttggtatggagattagtagcagta
gaggaaaatgtatggatacaacttacatttgatgaaagatttgggcttgaagacccagaa
gatgacatatgcaagtatgattttgtagaagttgaggaacccagtgatggaactatatta
gggcgctggtgtggttctggtactgtaccaggaaaacagatttctaaaggaaatcaaatt
aggataagatttgtatctgatgaatattttccttctgaaccagggttctgcatccactac
aacattgtcatgccacaattcacagaagctgtgagtccttcagtgctacccccttcagct
ttgccactggacctgcttaataatgctataactgcctttcgtaccttggaagaccttatt
cgatatcttgaaccagagagatggcaggtggacttagaagatctatataggccaacttgg
caacttcttggcaaggcttttgtttttggaagaaaatccagagtggtggatctgaacctt
ctaacggaggaggtaagattatacagctgcacacctcgtaacttctcagtgtccataagg
gaagaactaaagagaaccgataccattttctggccaggttgtctcctggttaaacgctgt
ggtgggaactgtgcctgttgtctccacaattgcaatgaatgtcaatgtgtcccaagcaaa
gttactaaaaaataccacgaggtccttcagttgagaccaaagaccggtgtcaggggattg
cataaatcactcaccgacgtggccctggagcaccatgaggagtgtgactgtgtgtgcaga
gggagcacaggaggatag

KEGG   Pongo abelii (Sumatran orangutan): 100440212
Entry
100440212         CDS       T01416                                 

Gene name
PDGFA
Definition
(RefSeq) platelet-derived growth factor subunit A isoform X1
  KO
K04359  platelet-derived growth factor subunit A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04540  Gap junction
pon04630  JAK-STAT signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05206  MicroRNAs in cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05231  Choline metabolism in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100440212 (PDGFA)
   04014 Ras signaling pathway
    100440212 (PDGFA)
   04015 Rap1 signaling pathway
    100440212 (PDGFA)
   04630 JAK-STAT signaling pathway
    100440212 (PDGFA)
   04020 Calcium signaling pathway
    100440212 (PDGFA)
   04072 Phospholipase D signaling pathway
    100440212 (PDGFA)
   04151 PI3K-Akt signaling pathway
    100440212 (PDGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100440212 (PDGFA)
   04540 Gap junction
    100440212 (PDGFA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100440212 (PDGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100440212 (PDGFA)
   05202 Transcriptional misregulation in cancer
    100440212 (PDGFA)
   05206 MicroRNAs in cancer
    100440212 (PDGFA)
   05231 Choline metabolism in cancer
    100440212 (PDGFA)
  09162 Cancer: specific types
   05214 Glioma
    100440212 (PDGFA)
   05218 Melanoma
    100440212 (PDGFA)
   05215 Prostate cancer
    100440212 (PDGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100440212 (PDGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100440212 (PDGFA)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100440212 (PDGFA)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100440212 (PDGFA)
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 100440212
NCBI-ProteinID: XP_024097071
LinkDB
Position
7
AA seq 220 aa
MRTLACLLLLGCGYLAHVLAEEAEIPREVIERLAHSQIHSIRDLQRLLEIDSVGSEESLD
TSLRVHGVHATKHASEKRPLPIRRKRSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIW
PPCVEVKRCTGCCNTSSVKCQPSRIHHRSVKVAKVEYIRKKPKLKEVQVRLEEHLECACA
TTSLNPDYREEDTGEWLPSSASVLENRSSEPCFWGVRWPP
NT seq 663 nt   +upstreamnt  +downstreamnt
atgaggaccttggcttgcctgctgctcctcggctgcggatacctcgcccatgttctggcc
gaggaagccgagatcccccgcgaggtgatcgagaggctggcgcacagtcagatccacagc
atccgggacctccagcgactcctggagatagactccgtagggagtgaggagtctttggac
accagcctgagagttcacggggtccacgccactaagcatgcgtccgagaagcggcccctg
cccattcgaaggaagagaagcatcgaggaagctgtccccgctgtctgcaagaccaggacg
gtcatttacgagattcctcggagtcaggttgaccccacgtccgccaacttcctgatctgg
cccccgtgcgtggaggtgaaacgctgcaccggctgctgcaacaccagcagcgtcaagtgc
cagccctcacgcatccaccaccgcagtgtcaaggtcgccaaggtggaatacatcaggaag
aagccaaaattaaaagaagtccaggtgaggttagaggagcatttggagtgcgcctgcgcg
accaccagcctgaatccggattatcgggaagaggacacgggtgagtggctgccttcatcg
gcatcagtgttggagaacaggtcttcagagccgtgcttttggggtgttaggtggccccct
tga

KEGG   Pongo abelii (Sumatran orangutan): 100444645
Entry
100444645         CDS       T01416                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I isoform X2
  KO
K05459  insulin-like growth factor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04114  Oocyte meiosis
pon04115  p53 signaling pathway
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04510  Focal adhesion
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04730  Long-term depression
pon04750  Inflammatory mediator regulation of TRP channels
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04935  Growth hormone synthesis, secretion and action
pon04960  Aldosterone-regulated sodium reabsorption
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05205  Proteoglycans in cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05410  Hypertrophic cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100444645 (IGF1)
   04014 Ras signaling pathway
    100444645 (IGF1)
   04015 Rap1 signaling pathway
    100444645 (IGF1)
   04066 HIF-1 signaling pathway
    100444645 (IGF1)
   04068 FoxO signaling pathway
    100444645 (IGF1)
   04151 PI3K-Akt signaling pathway
    100444645 (IGF1)
   04152 AMPK signaling pathway
    100444645 (IGF1)
   04150 mTOR signaling pathway
    100444645 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100444645 (IGF1)
   04115 p53 signaling pathway
    100444645 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100444645 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100444645 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100444645 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    100444645 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    100444645 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100444645 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    100444645 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100444645 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    100444645 (IGF1)
   04213 Longevity regulating pathway - multiple species
    100444645 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100444645 (IGF1)
   05202 Transcriptional misregulation in cancer
    100444645 (IGF1)
   05205 Proteoglycans in cancer
    100444645 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    100444645 (IGF1)
   05218 Melanoma
    100444645 (IGF1)
   05215 Prostate cancer
    100444645 (IGF1)
   05224 Breast cancer
    100444645 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100444645 (IGF1)
   05414 Dilated cardiomyopathy
    100444645 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100444645 (IGF1)
   01522 Endocrine resistance
    100444645 (IGF1)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100444645 (IGF1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 100444645
NCBI-ProteinID: XP_002823703
Ensembl: ENSPPYG00000004882
UniProt: A0A663DE66 A0A2J8XMA1
LinkDB
Position
12
AA seq 159 aa
MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKTQKYQPPSTNKNTKSQRRRKGSTFEEHK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtgaagatgcacaccatgtcctcctcgcatctcttctacctggcactgtgcctgctc
accttcaccagctctgccacggctggaccggagacgctctgcggggctgagctggtggat
gctcttcagttcgtgtgtggagacaggggcttttatttcaacaagcccacagggtatggc
tccagcagtcggagggcgcctcagacaggcatcgtggatgagtgctgcttccggagctgt
gatctgaggaggctggagatgtattgtgcacccctcaagcctgccaaatcagcccgctct
gtccgtgcccagcgccacaccgacatgcccaagacccagaagtatcagcccccatctacc
aacaagaacacgaagtctcagaggagaaggaaaggaagtacatttgaagaacacaagtag

KEGG   Pongo abelii (Sumatran orangutan): 100453978
Entry
100453978         CDS       T01416                                 

Gene name
INS
Definition
(RefSeq) insulin isoform X1
  KO
K04526  insulin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04072  Phospholipase D signaling pathway
pon04114  Oocyte meiosis
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04911  Insulin secretion
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04917  Prolactin signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04940  Type I diabetes mellitus
pon04950  Maturity onset diabetes of the young
pon04960  Aldosterone-regulated sodium reabsorption
pon05010  Alzheimer disease
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100453978 (INS)
   04014 Ras signaling pathway
    100453978 (INS)
   04015 Rap1 signaling pathway
    100453978 (INS)
   04066 HIF-1 signaling pathway
    100453978 (INS)
   04068 FoxO signaling pathway
    100453978 (INS)
   04072 Phospholipase D signaling pathway
    100453978 (INS)
   04022 cGMP-PKG signaling pathway
    100453978 (INS)
   04151 PI3K-Akt signaling pathway
    100453978 (INS)
   04152 AMPK signaling pathway
    100453978 (INS)
   04150 mTOR signaling pathway
    100453978 (INS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100453978 (INS)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100453978 (INS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100453978 (INS)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100453978 (INS)
   04910 Insulin signaling pathway
    100453978 (INS)
   04923 Regulation of lipolysis in adipocytes
    100453978 (INS)
   04913 Ovarian steroidogenesis
    100453978 (INS)
   04914 Progesterone-mediated oocyte maturation
    100453978 (INS)
   04917 Prolactin signaling pathway
    100453978 (INS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100453978 (INS)
  09149 Aging
   04211 Longevity regulating pathway
    100453978 (INS)
   04213 Longevity regulating pathway - multiple species
    100453978 (INS)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    100453978 (INS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100453978 (INS)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100453978 (INS)
   04940 Type I diabetes mellitus
    100453978 (INS)
   04950 Maturity onset diabetes of the young
    100453978 (INS)
   04932 Non-alcoholic fatty liver disease
    100453978 (INS)
   04931 Insulin resistance
    100453978 (INS)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 100453978
NCBI-ProteinID: XP_024110664
LinkDB
Position
11
AA seq 203 aa
MALWMRLLPLLALLALWGPDPAQAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
LQASALSPSSSTSTWPEGLDATARAPPALVATANIGQAGRSSSRQFRQRALGTSDSPVLF
IHCPGAAGTAQGLGYRGRRVTAELVWEEVDSSPQPQGSESLPAQPPAQPAPEPEPQQARV
AREPSPEVSCCGLWPRRPQRSQN
NT seq 612 nt   +upstreamnt  +downstreamnt
atggccctgtggatgcgcctcctgcccctgctggcgctgctggccctctggggacctgac
ccggcccaggcctttgtgaaccagcacctgtgcggctcccacctggtggaagctctctac
ctagtgtgcggggaacgaggcttcttctacacacccaagacccgccgggaggcagaggac
ctgcaggcctcagccttgtccccctcctcctccacatcaacctggccagagggtctggac
gccacagccagggcaccccctgctttggtggcgactgctaatattggccaggccggcaga
tcatcgtccaggcagtttcggcagagagccttgggcaccagtgactccccagtcctcttt
atccactgtccaggagctgcggggactgcgcagggactagggtacaggggccgaagagtc
accgccgagcttgtgtgggaggaggtggattccagcccccagccccagggctctgaatcg
ctgccagctcagccccctgcccagcctgccccagagcctgagccccagcaggccagagtg
gccagagagcccagtcctgaggtgagctgctgcggcctgtggcccaggcgaccccagcgc
tcccagaactga

KEGG   Pongo abelii (Sumatran orangutan): 100455021
Entry
100455021         CDS       T01416                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04540  Gap junction
pon04630  JAK-STAT signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05160  Hepatitis C
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05219  Bladder cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05226  Gastric cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100455021 (EGF)
   04012 ErbB signaling pathway
    100455021 (EGF)
   04014 Ras signaling pathway
    100455021 (EGF)
   04015 Rap1 signaling pathway
    100455021 (EGF)
   04630 JAK-STAT signaling pathway
    100455021 (EGF)
   04066 HIF-1 signaling pathway
    100455021 (EGF)
   04068 FoxO signaling pathway
    100455021 (EGF)
   04020 Calcium signaling pathway
    100455021 (EGF)
   04072 Phospholipase D signaling pathway
    100455021 (EGF)
   04151 PI3K-Akt signaling pathway
    100455021 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100455021 (EGF)
   04540 Gap junction
    100455021 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100455021 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100455021 (EGF)
   05231 Choline metabolism in cancer
    100455021 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100455021 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100455021 (EGF)
   05212 Pancreatic cancer
    100455021 (EGF)
   05226 Gastric cancer
    100455021 (EGF)
   05214 Glioma
    100455021 (EGF)
   05218 Melanoma
    100455021 (EGF)
   05219 Bladder cancer
    100455021 (EGF)
   05215 Prostate cancer
    100455021 (EGF)
   05213 Endometrial cancer
    100455021 (EGF)
   05224 Breast cancer
    100455021 (EGF)
   05223 Non-small cell lung cancer
    100455021 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100455021 (EGF)
   05165 Human papillomavirus infection
    100455021 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100455021 (EGF)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100455021 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition EGF cEGF EGF_CA DUF5050 EGF_3
Other DBs
NCBI-GeneID: 100455021
NCBI-ProteinID: XP_002815105
Ensembl: ENSPPYG00000014999
LinkDB
Position
4
AA seq 1208 aa
MLLTLIILLPVVLKFSFVSLSAPQHWSCPEGTLSGNGNSTCVGPAPFLIFSHGNSIFRID
TEGTNYAQLVVDAGVSVIMDFHYNEKRIYWVDLERQFLQRVFLNGSRQERVCNIEKNVSG
MAINWINEEVIWSNHQEGIITVTDMKGNNSHVLLSALKYPANIAVDPVERFIFWSSEVAG
SLYRADLDGVEVRALLETSEKITAVSLDVLEKRLFWIQYNREGSNSLICSCDYDGGSVHI
NKHPTQHNLFAMSLFGDHIFYSTWKTKTIWIANKHTGKDMVRINLHSSFVPPGELKVVHP
LAQPKAEDDAWEPEQKLRKLRKGNCSSTVCGQDPQSHLCTCAEGYALSRDRKYCEDVNEC
AFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPSNVSECSHDCVLTSEGPL
CFCPEGSVLERDGKTCSGCSSPDNGGCSQLCIPLSPVSWECDCFPGYDLQLDKKSCAASG
PQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGTVYALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLIEEGVDVPEGLAVDWIGRRFYWTDRGKSLIGRSDLNGKRSKIIMKENISQP
RGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCD
AKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVR
LQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKEMLGTAWCSCREGFMKASDGKTC
LALDGHQLLAGGEVDQKNQVTPLDILSKTRVSEDNITESQHMLVAEIMVSDQDDCAPVGC
STYARCISEGEDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCRCS
EGYRGDGIHCLDIDECQLGVHSCGENANCTNTEGGYTCMCDGRLSEPGLICPDSTPPPHL
REDDHHYSVRNSDSGCPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW
ELRHAGHGQQRKVTVVAVCVVVLVVLLLLSLWGAHYYRTQKLLSKNSKNPYEESSRDVRS
RRPADTEDGMSSCPQPWFVVIKEHKDLRNGSQPVAGEDGQAADVGSVQPTSWRQEPQLCG
MGTEQGCWIPVSSDNGSCPQVMERSFHMPSYGTQPLEGGVEKPHSLLSANPLWQQRALDP
PHQMELTQ
NT seq 3627 nt   +upstreamnt  +downstreamnt
atgctgctcactcttatcattctgttgccagtagttttaaaatttagttttgttagtctc
tcagcaccgcagcactggagctgtcctgaaggtactctctcaggaaatgggaattctact
tgtgtgggtcctgcacccttcttaattttctcccatggaaatagtatctttaggattgac
acagaaggaaccaattatgcgcaattggtggtggatgctggtgtctcagtgatcatggat
tttcattataatgagaaaagaatctattgggtggatttagaaagacaatttttgcaaaga
gtttttctgaacgggtcaaggcaagagagagtatgtaatatagagaaaaatgtttctgga
atggcaataaattggataaatgaagaagttatttggtcaaatcatcaggaaggaatcatt
acagtaacagatatgaaaggaaataattcccacgttcttttaagtgctttaaaatatcct
gcaaatatagcagttgatccagtagaaaggtttatattttggtcttcagaggtggctgga
agcctttatagagcagatctcgatggtgtggaagtgagggctctgctggagacatcagag
aaaataacagctgtgtcattggatgtgcttgagaagcggctgttttggattcagtacaac
agagaaggaagcaattctcttatttgctcctgtgattatgatggaggttctgtccacatt
aataaacatccaacacagcacaatttgtttgcaatgtccctttttggtgaccatatcttc
tattcaacatggaaaacgaagacaatttggatagccaacaaacacactgggaaggacatg
gttagaattaacctccattcatcatttgtaccacctggtgaactgaaagtagtgcatcca
ctcgcacaacccaaggcagaagatgatgcttgggagcctgagcagaaacttcgcaaattg
aggaaaggaaactgcagcagcactgtgtgtgggcaagacccccagtcacacttgtgcacg
tgtgcagagggatacgccctaagtcgagaccggaagtactgtgaagatgttaatgaatgt
gctttttggaatcatggctgtactcttgggtgtaaaaacacccctggatcctattactgc
acatgccctgtaggatttgttctgcttcctgatgggaaacgatgtcatcaacttgtttcc
tgtccaagcaatgtgtctgaatgcagccatgactgtgttctgacatcagaaggtccctta
tgtttctgtcctgaaggctcggtgcttgagagagatgggaaaacatgtagcggttgttcc
tcacctgataatggtggatgtagccagctctgcattcctctcagcccagtatcctgggaa
tgtgattgctttcctgggtatgacctacaactggataaaaaaagctgtgcagcttcagga
ccacaaccatttttgctgtttgccaattctcaagatattcgacacatgcattttgatgga
acagactatggaactctgctcagccagcagatgggaacggtttatgccctagatcatgac
cctgtggaaaataagatatactttgcccatacagccctgaagtggatagagagagctaat
atggatggttcccagcgagaaaggcttattgaggaaggagtagatgtgccagaaggtctt
gctgtggactggattggccgcagattctattggacagacagagggaaatctctgattgga
aggagtgatttaaatggaaaacgttccaaaataatcatgaaggagaacatctctcaacca
cgaggaattgctgttcatccaatggccaagagattattctggactgatacagggattaat
ccacgaattgaaagttcttccctccaaggccttggccgactggttatagccagctctgat
ctaatctggcccagtggaataacgattgacttcttaactgacaagttgtattggtgcgat
gccaagcagtctgtgattgaaatggccaatctggatggttcaaaacgccgaagacttacc
cagaatgatgtaggtcacccatttgctgtagccgtgtttgaggattatgtgtggttctca
gattgggctatgccatcagtaatgagagtaaacaagaggactggcaaagatagagtacgt
ctccaaggcagcatgctgaagccctcatcactggttgtggttcatccattggcaaaacca
ggagcagatccctgcttatatcaaaacggaggctgtgaacatatttgcaaagagatgctt
ggaactgcttggtgttcgtgtcgtgaaggttttatgaaagcctcagatgggaaaacgtgt
ctggctctggatggtcatcagctgttggcaggtggtgaagttgatcaaaagaaccaagta
acaccattggacatcttgtccaagactagagtgtcagaagataacattacagaatctcaa
cacatgctagtggctgaaatcatggtgtcagatcaagatgactgtgctcctgtgggatgc
agcacgtatgctcggtgtatttcagagggagaggatgccacatgtcagtgtttgaaagga
tttgctggggacggaaaactatgttctgatatagatgaatgtgagatgggtgtcccagtg
tgcccccctgcctcctccaagtgcatcaacaccgaagggggctatgtctgccggtgctca
gaaggctaccgaggagatgggattcactgtcttgatattgatgagtgccaactgggggtg
cacagctgtggagagaatgccaactgcacaaatacagagggaggctatacctgcatgtgt
gatggacgcctgtctgaaccaggactgatttgccctgactctactccaccccctcacctc
agggaagatgaccaccactattctgtaagaaatagtgactctggatgtcccctgtcccac
gatgggtactgcctccatgatggtgtgtgcatgtatattgaagcactggacaagtatgca
tgcaactgtgttgttggctacatcggggagcgatgtcagtaccgagacctgaagtggtgg
gaactgcgccacgctggccacgggcagcagcggaaggtcaccgtggtggctgtctgcgtg
gtggtgcttgtcgtgctgctcctcctgagcctgtggggggcccactactacaggactcag
aagctgctatcgaaaaattcaaagaatccttatgaggagtcgagcagagacgtgaggagt
cgcaggcctgctgacactgaggatgggatgtcctcttgccctcaaccttggtttgtggtt
ataaaggaacacaaagacctcaggaatgggagtcaaccagtggctggtgaggatggccag
gcagcagatgttgggtcagtgcaaccaacttcatggaggcaggagccccagttatgtgga
atgggcacagagcaaggctgctggattccagtatccagtgataacggctcctgtccccag
gtaatggagcgaagctttcatatgccctcctatgggacacagccccttgaagggggtgtt
gagaagccccattctctcctatcagctaacccattatggcaacaaagggccctggaccca
ccacaccaaatggagctgactcagtga

KEGG   Pongo abelii (Sumatran orangutan): 100460243
Entry
100460243         CDS       T01416                                 

Gene name
PDGFB
Definition
(RefSeq) platelet-derived growth factor subunit B
  KO
K17386  platelet-derived growth factor subunit B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04540  Gap junction
pon04630  JAK-STAT signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05211  Renal cell carcinoma
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05231  Choline metabolism in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100460243 (PDGFB)
   04014 Ras signaling pathway
    100460243 (PDGFB)
   04015 Rap1 signaling pathway
    100460243 (PDGFB)
   04630 JAK-STAT signaling pathway
    100460243 (PDGFB)
   04020 Calcium signaling pathway
    100460243 (PDGFB)
   04072 Phospholipase D signaling pathway
    100460243 (PDGFB)
   04151 PI3K-Akt signaling pathway
    100460243 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100460243 (PDGFB)
   04540 Gap junction
    100460243 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100460243 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460243 (PDGFB)
   05206 MicroRNAs in cancer
    100460243 (PDGFB)
   05231 Choline metabolism in cancer
    100460243 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    100460243 (PDGFB)
   05218 Melanoma
    100460243 (PDGFB)
   05211 Renal cell carcinoma
    100460243 (PDGFB)
   05215 Prostate cancer
    100460243 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100460243 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100460243 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100460243 (PDGFB)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100460243 (PDGFB)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100460243 (PDGFB)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 100460243
NCBI-ProteinID: XP_002831201
Ensembl: ENSPPYG00000011836
UniProt: A0A6D2WYR8 H2P4F5
LinkDB
Position
22
AA seq 241 aa
MNRCWALFLYLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAEL
DLNMTRSHSGDELESLARGRRSLGSLTVAEPAMIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVAAARPVTRSPGGSQDQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttcctgtatctctgctgctacctgcgtctggtcagcgcc
gagggggaccccattcccgaggagctctatgagatgctgagtgaccactcgatccgctcc
ttcgatgatctccagcgcctgctgcacggagaccccggagaggaagatggggccgagttg
gacctgaacatgacccgctcccactctggagacgagctggagagcttggctcgtggaaga
aggagcctgggttctctgaccgttgctgagccggccatgatcgctgagtgcaagacgcgc
accgaggtgttcgagatctcccggcgcctcatagaccgcaccaatgccaacttcctggtg
tggccgccctgcgtggaggtgcagcgctgctccggctgctgcaacaaccgcaacgtgcag
tgccgccccacccaggtgcagctgcgacctgtccaggtgagaaagatcgagattgtgcgg
aagaagccaatctttaagaaggccacggtgacgctggaggaccacctggcatgcaagtgt
gagacagtggcggctgcacggcctgtgacccgaagcccggggggttcccaggaccagcga
gccaaaacgccccaaactcgggtgaccattcggacggtgcgagtccgccggccccctaag
ggcaagcaccggaaattcaagcacacgcatgacaagacggcactgaaggagaccctcgga
gcctag

DBGET integrated database retrieval system