KEGG   Pongo abelii (Sumatran orangutan): 100172734
Entry
100172734         CDS       T01416                                 

Gene name
MAGI1
Definition
(RefSeq) membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
  KO
K05631  atrophin-1 interacting protein 3 (BAI1-associated protein 1)
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04530  Tight junction
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100172734 (MAGI1)
   04151 PI3K-Akt signaling pathway
    100172734 (MAGI1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100172734 (MAGI1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100172734 (MAGI1)
SSDB
Motif
Pfam: PDZ PDZ_6 MAGI_u5 PDZ_2 WW MAGI_u1 Tricorn_PDZ RPA43_OB
Other DBs
NCBI-GeneID: 100172734
NCBI-ProteinID: NP_001125806
UniProt: Q5RA44
LinkDB
Position
3
AA seq 1030 aa
MQNAGIVHAENEEEDDVPEMNSSLTAGSGEQDEHTLQETALPPVNSSIIAAPITDPSQKF
PQYLPLSAEDNLGPLPENWEMAYTENGEVYFIDHNTKTISWLDPRCLNKQQKPLEECEDD
EGVHTEELDSELELPAGWEKIEDPVYGIYYVDHINRKTQYENPVLEAKRKKQLEQQQQQQ
QQQQQQQQQQQQQQQTEEWTEDHSALVPPVIPNHPPSNPESAREAPLQGKPFFTRNPSEL
KGKFIHTKLRKSSRGFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTC
VLGHTHAQVVKIFQSIPIGASVDLELCRGYPLPFDPDDPNTSLVTSVAILDKEPIIVNGQ
ETYDSPASHSSKTGKVNGMKDARPSSPADVASNSSHGYPNDTVSLASSIATQPELITVHI
VKGPMGFGFTIADSPGGGGQRVKQIVDSPRCRGLKEGDLIVEVNKKNVQALTHNQVVDML
VECPKGSEVTLLVQRGGLPVPKKSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHSTQV
LPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINS
TNFGECPIPDYQEQDIFLWRKETGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGD
ELICVDGTPVIGKSHQLVVQLMQQAAKQGHVNLTVRRKVVFAVPKTENEVPSPASSHHSS
NQPASLTEEKRTPQGSQNSLNTVSSGSGSTSGIDSGGGGGSGVVSTVVQPYDVEIRRGEN
EGFGFVIVSSVSRPEAGTTFAGNACVAMPHKIGRIIEGSPADRCGKLKVGDRILAVNGCS
ITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNATLLTNAEKIATITTTHTPSQQGTQETR
NTTKPKQESQFEFKAPQATQEQDFYTVELERGAKGFGFSLRGGREYNMDLYVLRLAEDGP
AERCGKMRIGDEILEINGETTKNMKHSRAIELIKNGGRRVRLFLKRGDGSVPEYGGSNYE
NIPSFPGMTP
NT seq 3093 nt   +upstreamnt  +downstreamnt
atgcaaaatgctggcatagtccatgcggagaacgaggaggaggatgacgttcctgaaatg
aacagcagccttacagccggttctggtgaacaagacgagcacactctccaagaaacagca
ttaccacctgtgaatagtagcatcattgctgctcccatcacggacccttctcagaagttc
cctcaatacctacctctttctgcagaggataatttaggtcctctacctgaaaactgggag
atggcctataccgaaaatggagaagtctattttatagatcataacacgaaaacaatatct
tggttagaccctcggtgcctgaacaagcagcagaagcctctggaagagtgtgaagatgat
gaaggggtacacaccgaggagctggacagtgaactagaactgcctgctggttgggagaag
attgaagaccctgtctatggtatctactatgtagaccacatcaacaggaagacacaatat
gagaacccggttctagaagccaaacggaagaagcagcttgagcagcagcagcagcagcaa
cagcaacagcaacagcagcagcagcagcagcagcagcagcagcagacagaagaatggaca
gaagatcactcagcccttgtgcctcctgttattccaaaccaccctccaagcaatccagag
tcagccagagaagctccacttcagggcaaacccttttttacacgaaacccttctgagttg
aaaggcaagttcattcacacaaagctgcggaaaagcagtcgtggctttggcttcacggtg
gttggaggggatgaacctgatgagtttctccagatcaagagcttggtcctagatggtcct
gctgcactggatggcaagatggaaacaggggatgtgattgtcagtgtgaatgacacctgt
gttttgggacacacacatgctcaagttgtgaagatcttccagtccatccccattggtgcc
agcgtggaccttgaactctgccgaggttatccattgccttttgatccagatgaccccaat
acaagtttagtgacctcggtagccattttggataaagaaccaattattgtgaatgggcaa
gagacctatgattcaccagctagccacagtagtaaaacaggcaaagtcaatggcatgaag
gatgccaggccaagcagcccagcggacgtggcttcaaatagttctcatggttatcctaat
gacactgtttctttggcttcctccatagccactcagccggaactcataactgttcatatt
gtcaaagggccaatgggctttggttttactatcgcagacagtcctggtgggggtggccaa
agagtgaaacagattgttgacagcccacggtgcagaggcctgaaagaaggggatctcata
gtggaagttaataagaagaacgtgcaggccctaactcacaaccaagtggtggatatgctg
gttgagtgtcctaagggaagtgaggtcacattgttggtgcaacgaggagggctgccagtt
cccaagaagagcccaaagtcgcaaccactggaaaggaaagacagccagaatagttctcag
cacagtgtttccagccaccgaagcctgcacacagcatccccaagccacagcacacaggtg
ctccccgagttcccacctgcagaggcccaagctccagatcaaactgacagctctggtcag
aaaaaaccagatccttttaaaatctgggcccagtccaggagcatgtatgaaaaccgacct
atgtcaccttcacctgcgtcgggattgagcaagggtgagagagagagagaaatcaattcc
acgaattttggagaatgtccgattccagattaccaggaacaggacatcttcctctggaga
aaagagactggatttggatttaggattctgggtggaaatgaaccaggggaacctatttat
attggtcacatcgtaccactgggtgctgctgatactgacggccgcctgaggtctggagat
gaattaatttgtgtggatgggacgccagtaattggaaaatcacaccagctcgtggtccag
cttatgcaacaagctgccaagcaaggccacgtcaatctcacggtgcggcgtaaagtggtt
tttgcggtgcccaaaaccgagaacgaggtgccctcgccagcctcctctcatcacagtagc
aaccagccagcctcgctgacggaagagaagcgcaccccgcagggcagccagaactcgctg
aacacggtgagctcgggcagcggcagcaccagcggcatcgacagtggcggcggcgggggt
agcggtgtggtcagcaccgtggtgcagccctacgacgtggagatcaggcgcggggagaac
gagggcttcggcttcgtcatcgtgtcctcggtgagcaggcccgaagcaggcacgaccttt
gcaggcaatgcatgtgtggctatgcctcacaaaataggtcggattattgaggggagccct
gctgaccgctgtggcaagctgaaagtaggagaccggatcttggcagtaaatggatgttcc
atcaccaacaaatcccattcagacattgtgaaccttatcaaggaagcgggaaacacagtt
accctccgcatcattcctggggatgagtcctcgaatgccaccttgctgaccaatgcagag
aagatcgccaccatcaccaccacacacaccccttctcagcaagggacccaggagacaagg
aataccaccaaaccaaagcaggaatcccagtttgagttcaaagccccccaggcaacacag
gagcaagatttttacactgtggaactggaaagaggagccaagggatttggctttagcctt
cgaggaggccgagagtataacatggacctctatgttctgcgcttagcagaggatggtcct
gcagagaggtgtggaaagatgaggattggtgatgaaattttagagatcaatggtgagacc
accaaaaacatgaagcattctcgagctatagaactgattaagaatggtggccgcagagtt
cgtctgtttctgaagcggggagacggctcagtaccagaatatggtgggtcaaactatgaa
aacattccttccttccctggcatgactccatga

KEGG   Pongo abelii (Sumatran orangutan): 100443388
Entry
100443388         CDS       T01416                                 

Gene name
MAGI2
Definition
(RefSeq) membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
  KO
K05629  atrophin-1 interacting protein 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100443388 (MAGI2)
   04151 PI3K-Akt signaling pathway
    100443388 (MAGI2)
SSDB
Motif
Pfam: PDZ PDZ_6 MAGI_u1 PDZ_2 WW MAGI_u5
Other DBs
NCBI-GeneID: 100443388
NCBI-ProteinID: XP_024105596
Ensembl: ENSPPYG00000017865
LinkDB
Position
7
AA seq 1282 aa
MELEKSGALLESGTYEDNYYGTPKPPAEPAPLLLNVTDQILPGATPSAEGKRKRNKSVSN
MEKASIEPPEEEEEERPVVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEEL
KEQMDDTKPTKPEDNEEPDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPE
ECKENELPYGWEKIDDPIYGTYYVDHINRRTQFENPVLEAKRKLQQHNMPHTELGTKPLQ
APGFREKPLFTRDASQLKGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQ
DGKMETGDVIVYINEVCVLGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSM
VPPLAIMERPPPVMVNGRHNYETYLEYISRTSQSVPDITDRPPHTLHSMPADGQLDGTYP
PPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEG
DLIVEINQQNVQNLSHTEVVDILKDCPIGSETSLIIHRGGFFSPWKTPKPIMDRWENQGS
PQTSLSAPAIPQNLPFPPALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRRPDYKEL
DVHLRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKT
HRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSN
HAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRI
IDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPTS
APSSEKQSPMAQQSPLAQQSPLAQPSPATPNSPIAQPAPPQPLQLQGHENSYRSEVKARQ
DVKPDIRQPPFTDYRQPPLDYRQPPGGDYQQPPPLDYRQPPLLDYRQHSPDTRQYPLSDY
RQPQDFDYFTVDMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEI
NGESTRDMTHARAIELIKSGGRRVRLLLKRGTGQVPEYDEPAPWSSPAAAAPSLPEVGVS
LDDGLAPFSPSHPAPPSDPSHQISPGPTWDIKREHDVRKPKELSACGQKKQRLGEQRERS
ASPQRAARPRLEEAPGGQGRPEAGRPASEARAPGLAAADAADAARAGGKEAPRVAAGSEL
CRREGPGATPAFSGPGGGGGGGGSGAREAEGRVGARAGPRPGPRPPGGAPARKAAVAPGP
WKVPGSDKLPGVLKPGASAASR
NT seq 3849 nt   +upstreamnt  +downstreamnt
atggaattggagaaaagtggtgctctcctagaaagtgggacttatgaagacaattactac
ggtaccccaaagccgccagcagaaccagcaccattattgttaaatgtaacagaccagata
cttccaggagccactccaagtgctgaaggaaaacggaagaggaataaatcagtgagcaac
atggagaaagccagtatagagcctcctgaggaggaagaggaagagaggcctgtagtcaat
ggaaatggagtagtagtaacaccagaatccagtgaacatgaagacaaaagtgcaggtgcc
tcaggggagatgccctcccagccttatcctgcaccagtgtacagtcagcctgaggagttg
aaggagcagatggatgacacaaagccaactaaacctgaagacaatgaggaaccagaccca
ttgcctgataactgggaaatggcctatacagagaagggcgaagtctacttcattgaccat
aacacaaagacaacatcatggctggatccacgacttgcgaaaaaggctaaacctccagaa
gagtgcaaagaaaatgagcttccatatggctgggaaaaaatcgatgatcccatttatggc
acttattatgttgaccacataaatagaagaacacagtttgaaaatcctgtactggaagca
aaaaggaagctacagcaacataacatgccccacacagaacttggaacaaagcccctgcag
gccccaggtttccgagaaaaaccactcttcacccgggatgcatcccagttgaagggaaca
ttcctcagcaccaccctaaaaaagagcaacatgggttttggatttaccatcattggtgga
gacgagcctgatgagtttctgcaggtgaaaagtgtgattccggatgggcctgcagcacag
gatggaaaaatggaaacaggtgatgtcattgtctatattaatgaagtttgtgtccttgga
cacactcatgcagatgttgtcaaacttttccagtctgttcctattggtcagagtgtcaac
ctggtgttgtgtcgtggctaccctttgccctttgatcctgaagaccctgctaacagcatg
gtgccaccccttgcaataatggagaggccacctccagtgatggtcaatggaagacacaac
tatgaaacatatttggagtacatttctcggacctcacagtcagttccagatataacagat
cggccgcctcatactttgcactctatgccagctgatggtcagctagacggcacgtatcca
ccgcccgtccatgatgacaatgtgtctatggcttcatctggggccacccaagctgaactt
atgaccttaaccattgtgaaaggtgcccagggcttcggcttcactattgctgacagtcct
acaggacagcgggtgaaacaaatacttgacattcagggatgccctggcctgtgtgaaggc
gacctcattgttgagatcaaccagcagaatgtacagaacctgagccatacagaagtagtg
gatatacttaaggactgtcccattggaagtgaaacttctttgattatccatcgaggaggt
ttcttttctccatggaaaactccaaagcctataatggaccgatgggagaatcaaggcagt
cctcaaacgagtttatctgctccggccataccgcagaacctgcccttcccacctgccctt
cacaggagctcctttcctgactcaacagaggcctttgacccacggaagcctgatccatat
gagctctacgagaaatctagggccatttatgaaagtaggcgtccggattataaggaattg
gatgttcaccttcggaggatggagtctggatttggcttcagaatcctcgggggagatgag
cctggacagcctattttgattggagctgtcattgccatgggctcagccgacagagacggc
cgccttcacccaggagatgagcttgtgtatgttgatgggattccagtagccggcaaaacc
caccgctatgtcatcgacctcatgcaccacgcagcccgcaatgggcaggtcaacctcact
gtgagaagaaaggtgctatgtggaggggagccctgcccagagaacgggagaagtccaggc
tctgtatccacccaccacagctctccacgcagtgactacgcaacctacaccaacagcaac
cacgctgcccccagtagcaatgcctctccccctgaaggcttcgcctcccacagcctgcag
accagtgatgtggtcattcaccgcaaagagaacgagggcttcggctttgtcatcatcagc
tccctgaacaggcctgagtctggatccactataactgtgccccataaaatcggacgcatc
attgatgggagtcctgcagatcgctgtgcaaaactaaaagtgggagaccggatcctagca
gtgaatggccagtctatcatcaacatgcctcacgctgacatcgtgaagctcatcaaggat
gcaggtcttagtgtcacccttcgcatcattcctcaggaggagctcaacagccccacctcg
gcacccagctcagagaagcagagtcccatggcgcagcagagtcccctggcacagcagagt
cccctggcccagccaagcccagccacccccaacagccccatcgcccagccagcaccacct
caaccacttcagctgcaaggacacgaaaatagttacaggtcggaagtgaaagcaaggcaa
gatgtgaaaccagacatccgacagcctccattcacagactacaggcagcccccgctggac
tacaggcaacccccaggaggggactaccagcagcccccgcccttggactacaggcagcct
cccctgctggactacaggcagcactcccccgacaccaggcagtaccctctgtcggactac
agacaaccccaggattttgattatttcactgtggacatggagaaaggagccaaaggattt
ggattcagcattcgtggaggaagggaatacaaaatggatttgtatgtgttgagactggca
gaagatggaccagcaataaggaatgggaggatgagggtaggagatcaaatcattgaaatc
aatggggaaagcacaagggacatgacacatgccagagcaatagaactcatcaaatctgga
ggaagacgagtgaggctgctgctcaagagaggcacgggacaggtcccagaatatgacgaa
cccgccccctggagttctcccgctgccgccgccccaagtctgccggaagtaggcgtctcc
ctggacgacggcctcgctccattctctccatcacatccagccccaccctccgacccttcc
caccagataagcccaggcccaacttgggatatcaaacgggaacacgacgttaggaaacca
aaggagctttcagcctgcggccagaagaagcagcgcctcggggagcagagggagcgctcg
gcgagtccgcagagggccgcgcggccgaggctcgaggaggcgcccggcggccaggggcgg
cccgaggccggcaggcccgcctcggaagccagggcgcccgggcttgcggcggcagacgcg
gcggacgcggcgcgggcgggcgggaaggaggcgccccgtgtggcggcgggctccgagctc
tgccggcgcgaaggcccgggggctacgccggcgttctccggcccgggcggcggcggcggc
ggcggcggcagcggcgcgcgggaggccgagggcagggtgggtgcgcgcgcgggtccccgg
ccgggcccgcgacccccggggggcgcccccgcgcgcaaggccgccgtcgcgccgggtccc
tggaaggtgccgggctctgacaagctgccgggcgtcctcaaacccggcgcctcggccgcc
agcagatga

DBGET integrated database retrieval system