KEGG   Pongo abelii (Sumatran orangutan): 100172786
Entry
100172786         CDS       T01416                                 

Gene name
CD44
Definition
(RefSeq) CD44 antigen precursor
  KO
K06256  CD44 antigen
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04512  ECM-receptor interaction
pon04640  Hematopoietic cell lineage
pon05169  Epstein-Barr virus infection
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100172786 (CD44)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100172786 (CD44)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100172786 (CD44)
   05205 Proteoglycans in cancer
    100172786 (CD44)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100172786 (CD44)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100172786 (CD44)
   04090 CD molecules [BR:pon04090]
    100172786 (CD44)
   00535 Proteoglycans [BR:pon00535]
    100172786 (CD44)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100172786 (CD44)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100172786 (CD44)
  Exosomal proteins of other body fluids (saliva and urine)
   100172786 (CD44)
  Exosomal proteins of colorectal cancer cells
   100172786 (CD44)
  Exosomal proteins of bladder cancer cells
   100172786 (CD44)
CD molecules [BR:pon04090]
 Proteins
  100172786 (CD44)
Proteoglycans [BR:pon00535]
 Cell surface proteoglycans
  Others
   100172786 (CD44)
Glycosaminoglycan binding proteins [BR:pon00536]
 Hyaluronan
  Cell surface receptors
   100172786 (CD44)
SSDB
Motif
Pfam: Xlink
Other DBs
NCBI-GeneID: 100172786
NCBI-ProteinID: NP_001125856
UniProt: Q5R9V4
LinkDB
Position
11
AA seq 493 aa
MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTL
PTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN
ASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSS
GSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATNMDSSHSTTLQPTANPNT
GLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNH
SEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTF
HPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIA
VNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSETPDQFMTADE
TRNLQNVDMKIGV
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggacaagttttggtggcacgcagcctggggactctgcctcgtgccgctgagcctggcg
cagatcgatttgaatataacctgccgctttgcaggtgtattccacgtggagaaaaatggt
cgctacagcatctctcggacggaggccgctgacctctgcaaggctttcaatagcaccttg
cccacaatggcccagatggagaaagctctgagcatcggatttgagacctgcaggtatggg
ttcatagaagggcacgtggtgattccccggatccaccccaactccatctgtgcagcaaac
aacacaggggtgtacatcctcacatccaacacctcccagtatgacacatattgcttcaat
gcttcagctccacctgaagaagattgtacatcagtcacagacctgcccaatgcctttgat
ggaccaattaccataactattgttaaccgtgatggcacccgctatgtccagaaaggagaa
tacagaacgaatcctgaagacatctaccccagcaaccctactgatgatgacgtgagcagc
ggctcctccagtgaaaggagcagcacttcaggaggttacatcttttacaccttttctact
gtacaccccatcccagacgaagacagtccctggatcactgacagcacagacagaatccct
gctaccaatatggactccagtcatagtacaacgcttcagcctactgcaaatccaaacacg
ggtttggtggaagatttggacaggacaggacctctttcaatgacaacgcagcagagtaat
tctcagagcttctctacatcacatgaaggcttggaagaagataaagaccatccaacaact
tctactctgacatcaagcaataggaatgatgtcacaggtggaagaagagacccaaatcat
tctgaaggctcaactactttactggaaggttatacctctcattacccacacacgaaggaa
agcaggaccttcatcccagtgacctcagctaagactgggtcctttggagttactgcagtt
actgttggagattccaactctaatgtcaatcgttccttatcaggagaccaagacacattc
caccccagtggggggtcccataccactcatggatctgaatcagatggacactcacatggg
agtcaagaaggtggagcaaacacaacctctggtcctataaggacaccccaaattccagaa
tggctgatcatcttggcatccctcttggccttggctttgattcttgcagtttgcattgca
gtcaacagtcgaagaaggtgtgggcagaagaaaaagctagtgatcaacagtggcaatgga
gctgtggaggacagaaagccaagtggactcaacggagaggccagcaagtctcaggaaatg
gtgcatttggtgaacaaggagtcgtcagaaactccagaccagtttatgacagctgatgag
acaaggaacctgcagaatgtggacatgaagattggggtgtaa

DBGET integrated database retrieval system