KEGG   Pongo abelii (Sumatran orangutan): 100172820
Entry
100172820         CDS       T01416                                 

Gene name
SLC7A8
Definition
(RefSeq) large neutral amino acids transporter small subunit 2
  KO
K13781  solute carrier family 7 (L-type amino acid transporter), member 8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    100172820 (SLC7A8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100172820 (SLC7A8)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   100172820 (SLC7A8)
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-GeneID: 100172820
NCBI-ProteinID: NP_001125888
Ensembl: ENSPPYG00000005660
UniProt: Q5RAE3
LinkDB
Position
14
AA seq 535 aa
MEEGARHRNNTEKKHPGGGESDASPEAGSGGGGVALKKEIGLVSACGIIVGNIIGSGIFV
SPKGVLENAGSVGLALIVWIVTGFITVVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGF
LRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSV
RWATRVQDIFTAGKLLALALIIIMGIVQICKGEYFWLEPKNAFENFQEPDIGLVALAFLQ
GSFAYGGWNFLNYVTEELVDPYKNLPRATFISIPLVTFVYVFANVAYVTAMSPQELLASN
AVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVK
RCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRRKKPDIPRPI
KINLLFPIIYLLFWAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFSDFI
ELLTLVSQKMCVVVYPEVERGSGTEEANEDIEEQQQPMYQPTPTKDKDVAGQPQP
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggaagaaggagccaggcaccgaaacaacaccgaaaagaaacacccaggtgggggcgag
tcggacgccagccccgaggctggttccggggggggcggagtagccctgaagaaagagatc
ggattggtcagtgcctgtggtatcatcgtagggaacatcatcggctctggaatctttgtc
tcgccaaagggagtgctggagaatgccggttctgtgggccttgctctcatcgtctggatc
gtgacaggcttcatcacagttgtgggagccctctgctatgctgaactcggggtcaccatc
cccaaatctggaggtgactactcctatgtcaaggacatcttcggaggactggctgggttc
ctgaggctgtggattgctgtgctggtgatctaccccaccaaccaggctgtcatcgccctc
accttctccaactatgtgctgcagccactcttccccacctgcttccccccagagtctggc
cttcggctcctggctgccatctgcttattgctcctcacatgggtcaactgttccagtgtg
cggtgggccacccgggttcaagacatcttcacagctgggaagctcctggccttggccctg
attatcatcatggggattgtacagatatgcaaaggagagtacttctggctggagccaaag
aacgcatttgaaaatttccaggaacctgacatcggcctcgtcgcactggctttccttcag
ggctcctttgcctatggaggctggaactttctgaattacgtgactgaggaacttgttgat
ccctacaagaaccttcccagagccaccttcatctccatcccactggtcacatttgtgtat
gtctttgccaatgtcgcttatgtcactgcaatgtccccccaggagctgctggcatccaac
gccgtcgctgtgacttttggagagaagctcctaggagtcatggcctggatcatgcccatt
tctgttgccctgtccacgtttggaggagttaatgggtctctcttcacctcctctcggctg
ttcttcgctggagcccgagagggccaccttcccagtgtgttggccatgatccacgtgaag
cgctgcaccccaatcccagccctgctcttcacatgcatctccaccctgctgatgctggtc
accagcgacatgtacacactcatcaactatgtgggcttcatcaactacctcttctatggg
gtcacggttgctggacagatagtccttcgccggaagaagcctgatatcccccgccccatc
aagatcaacctgctgttccccatcatctacttgctgttctgggccttcctgctggtcttc
agcctgtggtcagagccggtggtatgtggcattggcctggccatcatgctgacaggagtg
cccgtctatttcctgggtgtttactggcaacacaagcccaagtgtttcagtgacttcatt
gagctgctaaccctggtgagccagaagatgtgtgtggtcgtgtaccccgaggtggagcgg
ggctcagggacagaggaggctaatgaggacatagaggagcagcagcagcccatgtaccaa
cccactcccaccaaggacaaggacgtggcggggcagccccagccctga

DBGET integrated database retrieval system