KEGG   Pongo abelii (Sumatran orangutan): 100172865
Entry
100172865         CDS       T01416                                 

Gene name
GSN
Definition
(RefSeq) gelsolin
  KO
K05768  gelsolin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100172865 (GSN)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100172865 (GSN)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100172865 (GSN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100172865 (GSN)
   04147 Exosome [BR:pon04147]
    100172865 (GSN)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Gelsolin / villin
     100172865 (GSN)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100172865 (GSN)
SSDB
Motif
Pfam: Gelsolin
Other DBs
NCBI-GeneID: 100172865
NCBI-ProteinID: NP_001125931
Ensembl: ENSPPYG00000019562
UniProt: Q5R9H7
LinkDB
Position
9
AA seq 731 aa
MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYD
LHYWLGNECSQDESGAAAIFTVQLVDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGG
VASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNDIHQWCGSN
SNRFERLKATQVSKGIRDNERSGRARVHVSEEGAEPEAMLQVLGPKPALPAGTEDTAKED
AANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQAN
TEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLS
SHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGG
DSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKE
PAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN
DAFVLKTPSAAYLWVGTGASKAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKSAY
RTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDPATDDVMLLDTWDQVFVWV
GKDSQEEEKTEALTSAKRYIETDLANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVD
PLDRAIAELAA
NT seq 2196 nt   +upstreamnt  +downstreamnt
atggtggtggaacaccccgagttcctcaaggcagggaaggagcctggcctgcagatctgg
cgtgtggagaagtttgatctggtgcccgtgcccaccaacctttatggagacttcttcacg
ggcgacgcctacgtcatcctgaagacagtgcagctgaggaatggaaatctgcagtacgac
ctccactactggctgggcaatgagtgcagccaggatgagagcggggcggccgccatcttt
accgtgcagctggttgactacctgaacggccgggccgtgcagcaccgtgaggtccagggc
tttgagtcggccaccttcctaggctacttcaagtctggcctgaagtacaagaaaggaggt
gtggcatcgggattcaagcacgtggtacccaacgaggtggtggtacagagactcttccag
gtcaaagggcggcgtgtggtccgtgccaccgaggtacctgtgtcctgggagagcttcaac
aatggcgactgcttcatcctggacctgggcaatgacatccaccagtggtgtggttccaac
agcaatcggtttgaaagactgaaggccactcaggtgtccaagggcatccgggacaacgag
cggagtggccgggcccgagtgcacgtgtctgaggagggcgctgagcctgaggcgatgctt
caggtgctgggccccaagccggctctgcctgcaggtaccgaggacaccgccaaggaggat
gcggccaaccgcaagctggccaaactctacaaggtctccaatggtgcagggaccatgtcc
gtctccctcgtggctgatgagaaccccttcgcccagggggccctgaagtcagaggactgc
ttcatcctggaccatggcaaggatgggaaaatctttgtctggaaaggcaagcaggcaaac
acagaggagaggaaggctgccctcaaaacagcctctgacttcatcaccaagatggactac
cccaagcagactcaggtctcggtccttcccgagggcggtgagaccccactgttcaagcag
ttcttcaagaactggcgggacccagaccagacagatggcctgggcttgtcctacctttcc
agccatatcgccaacgtggagcgggtgcccttcgacgccgccacactgcacacctccact
gccatggccgcccagcacggcatggatgatgatggcacaggccagaaacagatctggaga
attgaaggttccaacaaagtgcccgtggaccctgccacatatggacagttctatggaggc
gacagctacatcattctgtacaactaccgccatggtggccgccaggggcagataatctac
aactggcagggtgcccagtctacccaggatgaggtcgctgcgtctgccatcctgactgct
cagctggatgaggagctgggaggtacccctgtccagagccgtgtggtccaaggcaaggag
cccgcccacctcatgagcctgtttggtgggaagcccatgatcatctacaagggcggcacc
tcccgcgagggcgggcagacagcccctgccagcacccgcctcttccaggtccgcgccaac
agcgctggagccacccgggctgtcgaggtattgcctaaggctggtgcactgaactccaac
gatgcctttgttctgaaaaccccctcagccgcctacctgtgggtgggtacaggagccagc
aaggcagagaagacgggggcccaggagctgctcagggtgctgcgggcccaacctgtgcag
gtggcagaaggcagcgagccagatggcttctgggaggccctgggcgggaagtctgcctac
cgcacctccccacggctgaaggacaagaagatggatgcccatcctcctcgcctctttgcc
tgctccaacaagattggacgttttgtgatcgaagaggttcctggtgagctcatgcaggaa
gacccggctacggatgatgtcatgcttctggacacctgggaccaggtctttgtgtgggtt
ggaaaggattctcaagaagaagaaaagacagaagccttgacttctgctaagcggtacatc
gagacggacctagccaatcgggatcggcggacgcccatcaccgtggtgaagcaaggcttt
gagcctccctccttcgtgggctggttccttggctgggatgatgattactggtctgtggac
cccttggacagggccatcgctgagctggctgcctga

KEGG   Pongo abelii (Sumatran orangutan): 100441440
Entry
100441440         CDS       T01416                                 

Gene name
SCIN
Definition
(RefSeq) adseverin isoform X1
  KO
K05768  gelsolin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100441440 (SCIN)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100441440 (SCIN)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100441440 (SCIN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100441440 (SCIN)
   04147 Exosome [BR:pon04147]
    100441440 (SCIN)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Gelsolin / villin
     100441440 (SCIN)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100441440 (SCIN)
SSDB
Motif
Pfam: Gelsolin
Other DBs
NCBI-GeneID: 100441440
NCBI-ProteinID: XP_002818239
Ensembl: ENSPPYG00000017773
UniProt: H2PMT0 A0A6D2Y7L5
LinkDB
Position
7
AA seq 715 aa
MARELYYEEFARAGKQAGLQVWRIEKLELVPVPQSAHGDFYVGDAYLVLHTAKTSRGFTY
RLHFWLGKECSQDESTAAAIFTVQMDDYLGGKPVQNRELQGYESNDFVSYFKGGLKYKAG
GVASGLNHVLTNDLTARRLLHVKGRRVVRATEVPLSWDSFNKGDCFIIDLGTEIYQWCGS
SCNKYERLKANQVATGIRYNERKGRSELIVVEEGSEPSELIEVLGEKPELPDGGNDDDII
ADISNRKMAKLYMVSDASGSMRVTVVAEENPFSMAMLLSEECFILDHGAAKQIFVWKGKD
ANPQERKAAMKTAEEFLQQMNYSKNTQIQVLPEGGETPIFKQFFKDWRDKDQSDGFGKVY
VTEKVAQIKQIPFDASKLHSSPQMAAQHYMVDDGSGKVEIWRVENNGRIQVDQNSYGEFY
GGDCYIILYTYPRGQIIYTWQGANATRDELTTSAFLTVQLDRSLGGQAVQIRVSQGKEPV
HLLSLFKDKPLIIYKNGTSKKGGQAPAPPTRLFQVRRNLASITRIVEVDVDANSLNSNDV
FVLKLPQNSGYIWVGKGASQEEEKGAEYVASVLKCKTLRIQEGKEPEEFWNSLGGKKDYQ
TSPLLETQAEDHPPRLYGCSNKTGRFVIEEVPGEFTQDDLAEDDVMLLDAWEQIFIWIGK
DANEVEKKESLKSAKMYLETDPSGRDKRTPIVIIKQGHEPPTFTGWFLGWDSSKW
NT seq 2148 nt   +upstreamnt  +downstreamnt
atggcgcgggagctatactacgaggagtttgcccgggcgggcaagcaggcggggctgcag
gtctggaggattgagaagctggagctggtgcccgtgccccagagcgctcacggcgacttc
tacgtcggggatgcctacctggtgctgcacacggccaagacaagccgaggcttcacctac
cgcctgcacttctggctcggaaaggagtgttcccaggatgaaagcacagctgctgccatc
ttcactgttcagatggatgactatttgggtggcaagccagtgcagaatagagaacttcaa
ggatatgagtctaatgacttcgttagctatttcaaaggtggtctgaaatacaaggctgga
ggcgtggcatctggattaaatcatgttcttacgaacgacctgacagccaggaggctccta
catgtgaagggtcgtagagtggtgagagccacagaagttccccttagctgggacagtttc
aacaagggtgactgcttcatcattgaccttggcaccgaaatttatcagtggtgtggttcc
tcgtgcaacaaatatgaacgtctgaaggcaaaccaggtagctactggcattcgctacaat
gaaaggaaaggaaggtctgaactaattgtcgtggaagaaggaagtgaaccctcagaactt
atagaggtcttaggggaaaagccagagcttccagatggaggcaatgatgatgacattata
gcagacataagtaacaggaaaatggctaaactatacatggtttcagatgcgagtggctcc
atgagagtgactgtggtggcagaagaaaaccccttctcaatggcaatgctgctgtctgaa
gaatgctttattttggaccacggggctgcaaaacaaatttttgtatggaaaggtaaagat
gctaatccccaagagaggaaggctgcaatgaagacagctgaagaatttctacagcaaatg
aattattccaagaatacccaaattcaagttcttccagaaggaggtgaaacaccaatcttc
aaacagttctttaaggactggagagataaagatcagagtgatggcttcgggaaagtttat
gtcacagagaaagtggctcaaataaaacaaattccctttgatgcctcaaaattacacagt
tctccgcagatggcagcccagcactatatggtggatgatggttctggcaaagtggagatt
tggcgtgtagaaaacaatggtaggatccaagtcgaccaaaactcatatggtgaattctat
ggtggtgactgctacatcatactctatacctatcccagaggacagattatttacacgtgg
caaggagcaaatgccacacgagatgagctgacaacatctgccttcctgactgttcagttg
gatcggtccctcggaggacaggctgtgcagatccgagtctcccaaggcaaagagcctgtt
cacctgctgagtttgttcaaagacaaaccgctcattatttacaagaatggaacatcaaag
aaaggaggtcaggcacctgctccccctacacgcctctttcaagtccggagaaacctggca
tctatcaccagaattgtggaggttgatgttgatgcaaattcactgaattctaacgatgtt
tttgtcctgaaactgccacaaaatagtggctacatctgggtaggaaaaggtgctagccag
gaggaggagaaaggagcagagtatgtagcaagtgtcctcaagtgcaaaaccttaaggatc
caagaaggcaaggagccagaggagttctggaattcccttggagggaaaaaagactaccag
acctcaccactactggaaacccaggctgaagaccatccacctcggctttatggctgctct
aacaaaactggaagatttgttattgaagaggttccaggagagttcacacaggatgattta
gcagaagatgatgtcatgttactagatgcttgggaacagatatttatttggattggcaaa
gatgctaatgaagttgagaaaaaagaatctctgaagtctgccaaaatgtaccttgagaca
gacccttctggaagagacaagaggacaccaattgtcatcataaaacagggccatgagcca
cccacgttcacaggctggttcctgggctgggattccagcaagtggtaa

DBGET integrated database retrieval system