KEGG   Pongo abelii (Sumatran orangutan): 100172895
Entry
100172895         CDS       T01416                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04141  Protein processing in endoplasmic reticulum
pon04151  PI3K-Akt signaling pathway
pon04211  Longevity regulating pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04668  TNF signaling pathway
pon04728  Dopaminergic synapse
pon04911  Insulin secretion
pon04915  Estrogen signaling pathway
pon04918  Thyroid hormone synthesis
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon05020  Prion disease
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05034  Alcoholism
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100172895 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100172895 (ATF6B)
   04022 cGMP-PKG signaling pathway
    100172895 (ATF6B)
   04151 PI3K-Akt signaling pathway
    100172895 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100172895 (ATF6B)
   04915 Estrogen signaling pathway
    100172895 (ATF6B)
   04926 Relaxin signaling pathway
    100172895 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    100172895 (ATF6B)
   04918 Thyroid hormone synthesis
    100172895 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    100172895 (ATF6B)
   04925 Aldosterone synthesis and secretion
    100172895 (ATF6B)
   04927 Cortisol synthesis and secretion
    100172895 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100172895 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100172895 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    100172895 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100172895 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    100172895 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    100172895 (ATF6B)
   05031 Amphetamine addiction
    100172895 (ATF6B)
   05034 Alcoholism
    100172895 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100172895 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100172895 (ATF6B)
   05161 Hepatitis B
    100172895 (ATF6B)
   05163 Human cytomegalovirus infection
    100172895 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100172895 (ATF6B)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100172895 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 100172895
NCBI-ProteinID: NP_001125960
Ensembl: ENSPPYG00000016479
UniProt: Q5R9C6
LinkDB
Position
6
AA seq 703 aa
MAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDG
SSLDVGMDVSPPEPPWELLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPSSEALGVGE
VLHVKTESLAPPLCLLGDDPTSSFETVQINVVPTSDDSSDVQTKIEPVSPCSSINSEASL
LSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSPDGSSGKALPTR
KPPLQPKPVVLTTVPVPPRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQPEGPAPSLP
RPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAV
LADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPP
SAPISPWMNKGEPQPRRHLLGFSEQEPVHGVEPLQGSSQGPKEPQPSPTDQPSFSNLTAF
PGGTKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKS
QPRKKSPPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTFYVVSFRRD
HLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVIHIKTS
TVPPSLRKQPSPPPGNATGGPLPASAASQAHQASHQPLYLNHP
NT seq 2112 nt   +upstreamnt  +downstreamnt
atggcggagctgatgctcctcagtgagattgctgacccgacgcgtttcttcaccgacaac
ctgcttagcccggaggactggggtctgcagaacagcaccttgtattctggcctagatgaa
gtggccgaggagcagacgcagctcttccgttgcccggagcaggatgtcccgtttgacggc
agctccctggacgtggggatggatgtcagcccccctgagcccccatgggaactcctgccg
atcttcccagatcttcaggtgaagtctgagccatcttccccctgctcttcctcctccctc
agctccgagtcatcacgtctctccacagagccatccagtgaggctcttggggtaggggag
gtgctccatgtgaagacagagtccttggcacccccactgtgtctcctgggagatgaccca
acatcctcatttgaaaccgtccagatcaacgtagtccccacctctgatgattcctcagat
gtccagaccaagatagaacctgtctctccatgttcttccatcaactctgaggcctccctg
ctctcagccgactcctccagccaggcttttataggagaggaggtcctggaagtgaagaca
gaatccctgtccccttcaggatgcctcctgtgggatgtcccagccccctcacttggagct
gtccagatcagcatgggcccatcccctgatggctcctcagggaaagccctgcccacccgg
aagccgccactgcagcccaaacctgtggtgctaaccactgtcccagtgccacccagagct
gtgcctcccagtaccaccgtccttctgcagcccctcgtccagccacctccagtgtcccca
gttgtcctcatccagggtgctattcgagtccagcctgaagggccggctccctctctacca
cggcctgagaggaagagcatcgttcctgctcctatgcctggaaactcctgcccgcctgaa
gtggatgcaaagctgctgaagcggcagcagcgaatgatcaagaaccgggagtcagcctgc
cagtcccggagaaagaagaaagagtatctgcagggactggaggctcggctgcaggcagta
ctggctgacaaccagcagctccgccgggagaatgctgccctccggcggcggctggaggcc
ctgctggctgaaaacagcgagctcaagttaggatctggaaacaggaaggtggtctgcatc
atggtcttccttctcttcattgccttcaactttggacctgtcagcatcagtgagcctcct
tcagctcccatctctccttggatgaacaagggggagcctcaaccccggagacacttgctg
gggttctcagagcaagagccagttcatggagttgaacctctccaggggtcctcccagggc
cctaaggagccccagcccagccccacagaccagcccagtttcagcaacctgacagccttc
cctgggggcaccaaggagctactactaagagacctagaccagctcttcctctcctctgat
tgccggcacttcaaccgcaccgagtccctgaggcttgctgacgagttgagcggctgggtc
cagcgccaccagagaggccggcggaagatccctcagagggcccaggagagacagaagtct
cagccacggaagaagtcacctccagttaaggcagtccccatccaaccccctggaccccca
gaaagggattctgtgggccagctgcaactgtatcgccacccagaccgttcgcagccagcg
ttcttggatgcaattgaccgacgggaagacacgttttatgttgtctctttccgaagggac
cacctgctgctcccagccatcagccacaacaagacctcccggcccaagatgtccctggtg
atgcctgccatggcccccaatgagaccctttcaggccgtggggccccgggggactatgag
gagatgatgcagatcgagtgtgaggtcatggacaccagggtgattcacatcaagacctcc
acagtgcccccctcgctccgaaaacagccatccccaccaccaggcaatgccacaggtggc
cccttgccagcctctgcagccagccaggcccaccaggcctcccaccagcccctctacctc
aatcatccctga

DBGET integrated database retrieval system