KEGG   Pongo abelii (Sumatran orangutan): 100172935
Entry
100172935         CDS       T01416                                 

Gene name
CHRM1
Definition
(RefSeq) muscarinic acetylcholine receptor M1
  KO
K04129  muscarinic acetylcholine receptor M1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04024  cAMP signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04725  Cholinergic synapse
pon04810  Regulation of actin cytoskeleton
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100172935 (CHRM1)
   04024 cAMP signaling pathway
    100172935 (CHRM1)
   04151 PI3K-Akt signaling pathway
    100172935 (CHRM1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100172935 (CHRM1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100172935 (CHRM1)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100172935 (CHRM1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100172935 (CHRM1)
   05022 Pathways of neurodegeneration - multiple diseases
    100172935 (CHRM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100172935 (CHRM1)
G protein-coupled receptors [BR:pon04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    100172935 (CHRM1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srbc 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100172935
NCBI-ProteinID: NP_001125994
Ensembl: ENSPPYG00000003139
UniProt: Q5R949
LinkDB
Position
11
AA seq 460 aa
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETESRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPGTPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaacacctcagccccacctgctgtcagccccaacatcactgtcctggcaccaggaaag
ggtccctggcaagtggccttcattgggatcaccacgggcctcctgtcgctagccacagtg
acaggcaacctgctggtactcatctctttcaaggtcaacacggagctcaagacagtcaat
aactacttcctgctgagcctggcctgtgctgacctcatcatcggtaccttctccatgaac
ctctacaccacatacctgctcatgggccactgggctctgggcacactggcttgcgacctc
tggctggccctggactatgtggccagcaatgcctccgtcatgaatctgctgctcatcagc
tttgaccgctacttctccgtgactcggcccctgagctaccgcgccaagcgcacaccccgc
cgggcagctctgatgatcggcctggcctggctggtttcctttgtcctctgggccccagcc
atcctcttctggcagtacctggtaggggagcggacagtgttagctgggcagtgctacatc
cagttcctctcccagcccatcatcacctttggcacagccatggctgccttctacctccct
gtcacagtcatgtgcacgctctactggcgcatctaccgggagacagagagccgagcacgg
gagctggcagcccttcagggctctgagacaccaggcaaagggggtggcagcagcagcagc
tcagagaggtctcagccaggggctgagggctcaccagggactcctccaggccgctgctgt
cgctgctgccgggcccccaggctgctgcaggcctacagctggaaggaagaagaggaagag
gacgaaggctctatggagtccctcacatcctcagagggagaggagcctggctccgaagtg
gtgatcaagatgccaatggtggaccccgaggcgcaggcccccaccaagcagcccccacgg
agctccccaaatacagtcaagaggccgactaagaaagggcgtgatcgagctggcaagggc
cagaagccccgtggaaaggagcagctggccaaacggaagaccttctcactggtcaaggag
aagaaggcggctcggaccctgagtgccatcctcctggctttcatcctcacctggacaccg
tacaacatcatggtgctggtgtccaccttctgcaaggactgtgttcccgagaccctgtgg
gagctgggctactggctgtgctacgtcaacagcaccatcaaccccatgtgctacgcactc
tgcaacaaagccttccgggacacctttcgcctgctactgctttgccgctgggacaagaga
cgctggcgcaagatccccaagcgccccggctccgtgcaccgcactccctcccgccaatgc
tga

KEGG   Pongo abelii (Sumatran orangutan): 100432438
Entry
100432438         CDS       T01416                                 

Gene name
LPAR6
Definition
(RefSeq) lysophosphatidic acid receptor 6
  KO
K04273  lysophosphatidic acid receptor 6
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04072  Phospholipase D signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04151  PI3K-Akt signaling pathway
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100432438 (LPAR6)
   04151 PI3K-Akt signaling pathway
    100432438 (LPAR6)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100432438 (LPAR6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100432438 (LPAR6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100432438 (LPAR6)
G protein-coupled receptors [BR:pon04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    100432438 (LPAR6)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100432438
NCBI-ProteinID: XP_002824311
Ensembl: ENSPPYG00000005360
UniProt: H2NJV9
LinkDB
Position
13
AA seq 344 aa
MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLA
MSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVY
PFKSKTLRTKRNAKIVCIGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTY
LSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCF
CFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQN
SIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggtaagcgttaacagctcccactgcttctataatgactcctttaagtacactttgtat
gggtgcatgttcagcatggtgtttgtgcttgggttaatatccaattgtgttgccatatac
attttcatctgcgtcctcaaagtccgaaatgaaactacaacttacatgattaacttggca
atgtcagacttgctttttgtttttactttacccttcaggattttttacttcacaacacgg
aattggccatttggagatttactttgtaagatttctgtgatgctgttttataccaacatg
tacggaagcattctgttcttaacctgtattagtgtagatcgatttctggcaattgtctac
ccatttaagtcaaagactctaagaaccaaaagaaatgcaaagattgtttgcattggcgtg
tggttaactgtgatcggaggaagtgcacccgccgtttttgttcagtctacccactctcag
ggtaacaatgcctcagaagcctgctttgaaaattttccagaagccacatggaaaacatat
ctctcaaggattgtaattttcattgaaatagtgggattttttattcctctgattttaaat
gtaacttgttctagtatggtgctaaaaactttaactaaacctgttacattaagtagaagc
aaaataaacaaaactaaggttttaaaaatgatttttgtacatttgatcatattctgtttc
tgttttgttccttacaatatcaatcttattttatattctcttgtgagaacacaaacattt
gttaattgctcagttgtggcagcagtaaggacaatgtacccaatcactctctgtattgct
gtttcaaactgttgttttgatcctatagtttactactttacatcggacacaattcagaat
tcaataaaaatgaaaaactggtctgtcaggagaagtgacttcagattctctgaagttcat
ggtgcagagaattttattcagcataacctacagaccttaaaaagtaagatatttgacaat
gaatctgctgcctga

KEGG   Pongo abelii (Sumatran orangutan): 100444153
Entry
100444153         CDS       T01416                                 

Gene name
LPAR5
Definition
(RefSeq) lysophosphatidic acid receptor 5
  KO
K08390  lysophosphatidic acid receptor 5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100444153 (LPAR5)
   04072 Phospholipase D signaling pathway
    100444153 (LPAR5)
   04151 PI3K-Akt signaling pathway
    100444153 (LPAR5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100444153 (LPAR5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100444153 (LPAR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100444153 (LPAR5)
G protein-coupled receptors [BR:pon04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    100444153 (LPAR5)
SSDB
Motif
Pfam: 7tm_1 DUF898 7TM_GPCR_Srx 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 100444153
NCBI-ProteinID: XP_002822867
Ensembl: ENSPPYG00000004193
UniProt: H2NG89
LinkDB
Position
12
AA seq 372 aa
MLANSSSINSSVLPCPDYRPTHRLHLVVYSLVLAAGLPLNALALWVFLRALRVHSVVSVY
MCNLAASDLLFTLSLPVRLSYYALHHWPFPDLLCQTTGAIFQMNMYGSCIFLMLINVDRY
AAIVHPLRLRHLRRPRVARLLCLGVWALILVFAVPAARVHRPSRCRYRDLEVRLCFESFS
DELWKGRLLPLVLLAEALGFLLPLAAVVYSSGRVFWTLARPDATQSQRRRKTVRLLLANL
VIFLLCFVPYNATLAVYGLLRSKLVAASVPARDRVRGVLMVMVLLAGANCVLDPLVYYFS
AEGFRNTLRGLGTPHRARTLATNGTREALAQSERSAVTTDATRPDAASQGLLRPSDSHSL
SSFTQCPQDSAL
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgttagccaacagctcctcaatcaacagttctgttctcccgtgtcctgactaccgacct
acccaccgcctgcacttggtggtctacagcttggtgctggctgccgggctccccctcaac
gcgctggccctctgggtctttctgcgcgcgctgcgcgtgcactcggtggtgagcgtgtac
atgtgtaacctggcggccagcgacttactcttcacgctctcgctgcccgttcgtctctcc
tactacgcactacaccactggcccttccccgacctgctgtgccagacgacgggcgccatc
ttccagatgaacatgtacggcagctgcatctttctgatgctcatcaacgtggaccgctac
gccgccatcgtgcacccgctgcgactgcgccacctgcggcggccccgcgtggcgcggctg
ctctgcctgggcgtgtgggcgctcatcctggtgtttgccgtacccgccgcccgtgtgcac
aggccctcgcgctgccgctaccgggacctcgaggtgcgcctgtgcttcgagagcttcagc
gacgagctgtggaaaggtaggctgctgcccctcgtgctgctggccgaggcgctgggcttc
ctgctgcccctggcggcggtggtctactcgtcgggccgagtcttctggacgctggcgcgc
cccgacgccacgcagagccagcggcggcggaagaccgtgcgcctcctgctggctaacctc
gtcatcttcctgctgtgcttcgtgccctacaacgccacgctggcggtctacgggctgctg
cggagcaagctggtggcggccagcgtgcctgcccgcgatcgcgtgcgcggggtgctgatg
gtgatggtgctgctggccggcgccaactgcgtgctggacccgctggtgtactactttagc
gccgagggcttccgcaacaccctgcgcggcctgggcactccgcaccgggccaggaccttg
gccaccaacgggacgcgggaggcgctcgcgcaatctgaaaggtccgccgtcaccaccgac
gccaccaggccggatgccgccagtcaggggctgctccgaccctccgactcccactctctg
tcttccttcacacagtgtccccaggattccgccctctga

KEGG   Pongo abelii (Sumatran orangutan): 100447792
Entry
100447792         CDS       T01416                                 

Gene name
F2R
Definition
(RefSeq) proteinase-activated receptor 1
  KO
K03914  coagulation factor II (thrombin) receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04024  cAMP signaling pathway
pon04072  Phospholipase D signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04610  Complement and coagulation cascades
pon04611  Platelet activation
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100447792 (F2R)
   04020 Calcium signaling pathway
    100447792 (F2R)
   04072 Phospholipase D signaling pathway
    100447792 (F2R)
   04024 cAMP signaling pathway
    100447792 (F2R)
   04151 PI3K-Akt signaling pathway
    100447792 (F2R)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100447792 (F2R)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100447792 (F2R)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100447792 (F2R)
   04611 Platelet activation
    100447792 (F2R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100447792 (F2R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100447792 (F2R)
G protein-coupled receptors [BR:pon04030]
 Rhodopsin family
  Peptide
   Thrombin
    100447792 (F2R)
SSDB
Motif
Pfam: 7tm_1 DUF4064
Other DBs
NCBI-GeneID: 100447792
NCBI-ProteinID: XP_002815710
UniProt: A0A2J8VT58
LinkDB
Position
5
AA seq 425 aa
MGPRRLLLVTACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE
KNESGLTEYRLVSVNKSSSLQKPLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLN
IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA
AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLK
EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
TVANRSKKSRALFLSAAVFCIFIICFGPTNILLIAHYSFLSHTSTTEAAYFAYLLCVCVS
SISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
KKLLT
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggggccgcggcggctgctgctggtgaccgcctgcttcagtctgtgcggcccgctgttg
tctgcccgcacccgggcccgcaggccagagtcaaaagcaacaaatgccaccttagatccc
cggtcatttcttctcaggaaccccaatgataaatatgaaccattttgggaggatgaggag
aaaaatgaaagtgggttaactgaatacagattagtctccgtcaataaaagcagttctctt
caaaaaccacttcctgcattcatctcagaagatgcctccggatatctgaccagctcctgg
ctgacgctctttgtcccatctgtgtacaccggagtgtttgtagtcagcctcccactaaat
atcatggccatcgttgtgttcatcctgaaaatgaaggtcaagaagccggcggtggtgtac
atgctgcacctggccacggcagatgtgctctttgtgtctgtgctcccctttaagatcagc
tattacttttccggtagtgattggcagtttgggtctgaattgtgtcgctttgtcactgca
gcattttactgtaacatgtacgcctctatcttgctcatgacagtcataagcattgaccgg
tttctggctgtggtgtatcccatgcagtccctctcctggcgtactctgggaagggcttcc
ttcacttgtctggccatctgggctttggccatcgcaggggtagtgcctctgctcctcaag
gagcaaaccatccaggtgcccgggctcaacatcaccacctgtcatgatgtgctcaatgaa
accctgcttgaaggctactatgcctactacttctcagccttctctgctgtcttctttttt
gtgccactgatcatttccacggtctgttatgtgtctatcattcgatgtcttagctcttcc
acagttgccaaccgcagcaagaagtcccgggctttgttcctgtcagctgctgttttttgc
atcttcatcatttgcttcggacccacaaacatcctcctgattgcacattactcattcctt
tctcacacttccaccacagaggctgcctactttgcctacctcctctgtgtctgtgtcagc
agcataagctgctgcatcgaccccctaatttactattacgcttcctctgagtgccagagg
tacgtctacagtattttatgctgcaaagaaagttccgatcccagcagttataacagcagt
gggcagttgatggcaagtaaaatggatacctgctctagtaacctgaataacagcatatac
aagaagctgttaacttag

KEGG   Pongo abelii (Sumatran orangutan): 100448001
Entry
100448001         CDS       T01416                                 

Gene name
LPAR3
Definition
(RefSeq) lysophosphatidic acid receptor 3
  KO
K04294  lysophosphatidic acid receptor 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04072  Phospholipase D signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04151  PI3K-Akt signaling pathway
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100448001 (LPAR3)
   04072 Phospholipase D signaling pathway
    100448001 (LPAR3)
   04151 PI3K-Akt signaling pathway
    100448001 (LPAR3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100448001 (LPAR3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100448001 (LPAR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100448001 (LPAR3)
G protein-coupled receptors [BR:pon04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    100448001 (LPAR3)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 100448001
NCBI-ProteinID: XP_002810709
Ensembl: ENSPPYG00000001200
LinkDB
Position
1
AA seq 353 aa
MNECHYDKHMDFFYNRSNTDTVDDWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVIKNRK
FHFPFYYLLANLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWFLRQGLLDTSLTASLTNL
LVIAVERHMSIMRMRVHSNLTKKRVTLLILLVWAVAIFMGSVPTLGWNCLCNISACSSLA
PIYSRSYLVFWTVSNLMAFFIMVVVYLRIYVYVKRKTNVLSPHTSGSISRRRTPMKLMKT
VMTVLGAFVVCWTPGLVVLLLDGLNCRQCGVQHVKRWFLLLALLNSVMNPIIYSYKDEDM
YGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNKSSS
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgaatgagtgtcactatgataagcacatggactttttttataataggagcaacactgat
actgtcgatgactggacaggaacaaagcttgtgattgttttgtgtgttgggacgtttttc
tgcctgtttatttttttttctaattctctggtcattgcggcagtgatcaaaaacagaaaa
tttcatttccccttctactacctgttggctaatttagctgctgccgatttcttcgctgga
attgcctatgtattcctgatgtttaacacaggcccagtttcaaaaactttgactgtcaac
cgctggtttctccgtcaggggcttctggacactagcttgactgcttccctcaccaacttg
ctagttattgctgtggagaggcacatgtcaatcatgaggatgcgggtccatagcaacctg
actaaaaagagggtgacgctgctcattttgcttgtctgggccgttgccatttttatgggg
tcggtccccacactgggctggaattgcctctgcaacatctctgcctgctcttccctggcc
cccatttacagcaggagttaccttgttttctggacagtgtccaacctcatggccttcttc
atcatggttgtggtgtacctgcggatctacgtgtacgtcaagaggaaaaccaatgtcttg
tctccgcatacaagtgggtccatcagccgccggaggacacccatgaagctaatgaagacg
gtgatgactgtcttaggggcgtttgtggtatgctggaccccgggcctggtggttctgctc
ctcgacggcctgaactgcaggcagtgtggcgtgcagcacgtgaaaaggtggttcctgttg
ctggcgctgctcaactccgtcatgaaccccatcatctactcctacaaggacgaggacatg
tatggcaccatgaagaagatgatctgctgcttctctcaggagaacccagagaggcgtccc
tctcgcatcccctccacagtcctcagcaggagtgacacaggcagccagtacatagaggat
agtattagccaaggtgcagtctgcaataaaagcagttcctaa

KEGG   Pongo abelii (Sumatran orangutan): 100450243
Entry
100450243         CDS       T01416                                 

Gene name
CHRM2
Definition
(RefSeq) muscarinic acetylcholine receptor M2
  KO
K04130  muscarinic acetylcholine receptor M2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04024  cAMP signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04725  Cholinergic synapse
pon04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100450243 (CHRM2)
   04024 cAMP signaling pathway
    100450243 (CHRM2)
   04151 PI3K-Akt signaling pathway
    100450243 (CHRM2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100450243 (CHRM2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100450243 (CHRM2)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100450243 (CHRM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100450243 (CHRM2)
G protein-coupled receptors [BR:pon04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    100450243 (CHRM2)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 100450243
NCBI-ProteinID: XP_002818538
Ensembl: ENSPPYG00000018033
UniProt: A0A6D2W8H6 A0A2J8V3M8
LinkDB
Position
7
AA seq 466 aa
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKIDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgaataactcaacaaactcctctaacaatagcctggctcttaccagtccttataagaca
tttgaagtggtgtttattgtcctggtggctggatccctcagtttggtgaccattatcggg
aacatcctagtcatggtttccattaaagtcaaccgccacctccagactgtcaacaattac
tttttgttcagcttggcctgtgctgaccttatcataggtgttttctccatgaacttgtac
accctctacactgtgattggttactggcctttgggacctgttgtgtgtgacctttggcta
gccctggactatgtggtcagcaatgcctcggttatgaatctgctcatcatcagctttgac
aggtacttctgtgtcacaaaacctctgacctacccagtcaagcggaccacaaaaatggca
ggcatgatgattgcagctgcctgggtcctctctttcatcctctgggctccagccattctc
ttctggcagttcattgtaggggtgagaactgtggaggatggggagtgctacattcagttt
ttttccaatgctgctgtcacctttggtacggccattgcagccttctatttgccagtgatc
atcatgactgtgctgtactggcacatatcccgagccagcaagagcaggataaagaaggac
aagaaggagcctgttgccaaccaagaccccgtttctccaagtctggtacaaggaaggata
gtgaagccaaacaataacaacatgcccagcagtgacgatggcctggagcacaacaaaatc
cagaatggcaaagcccccagagatcctgtgactgaaaactgtgttcagggagaagagaag
gagagctccaatgactccacctcagtcagtgctgttgcctctaatatgagagatgacgaa
ataacccaggatgaaaacacagtctccacttccctgggccattccaaagatgagaattct
aagcaaacatgcatcagaattggcaccaagacccccaaaattgactcatgtaccccaact
aataccaccgtggaggtagtggggtcttcaggtcagaatggagatgaaaagcagaatatt
gtagcccgcaagattgtgaagatgactaagcagcctgcaaaaaagaagcctcctccttcc
cgggaaaagaaagtcaccaggacaatcttggctattctgttggctttcatcatcacttgg
gccccatacaatgtcatggtgctcattaacaccttttgtgcaccttgcatccccaacact
gtgtggacaattggttactggctttgttacatcaacagcactatcaaccctgcctgctat
gcactttgtaatgccaccttcaagaagacctttaaacaccttctcatgtgtcattataag
aacataggcgctacaaggtaa

KEGG   Pongo abelii (Sumatran orangutan): 100458628
Entry
100458628         CDS       T01416                                 

Gene name
LPAR2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04072  Phospholipase D signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100458628 (LPAR2)
   04072 Phospholipase D signaling pathway
    100458628 (LPAR2)
   04151 PI3K-Akt signaling pathway
    100458628 (LPAR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100458628 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100458628 (LPAR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100458628 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100458628 (LPAR2)
G protein-coupled receptors [BR:pon04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    100458628 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srt
Other DBs
NCBI-GeneID: 100458628
NCBI-ProteinID: XP_009251327
Ensembl: ENSPPYG00000009774
UniProt: H2NY70
LinkDB
Position
19
AA seq 351 aa
MVTMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASN
RRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVA
TLLAIAVERHRSVMAVQLHSRLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSR
MAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLV
KTVVIILGAFVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDA
EMRRTFRRLLCCACLRRSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggtcaccatgggccagtgctactacaacgagaccatcggcttcttctataacaacagt
ggcaaagagctcagctcccactggcggcccaaggatgtggtcgtggtggcactggggctg
accgtcagcgtgctggtgctgctgaccaatctgctggtcatagcagccatcgcctccaac
cgccgcttccaccagcccatctactacctgctcggcaacctggccgcggctgacctcttc
gcgggcgtggcctacctcttcctcatgttccacactggtccccgcacagcccgactttca
cttgagggctggttcctgcggcagggcttgctggacacaagcctcactgcgtcggtggcc
acactgcttgccatcgccgtggagcggcaccgcagtgtgatggccgtgcagctgcacagc
cgcctgccccgtggccgcgtggtcatgctcattgtgggtgtgtgggtggctgccctgggc
ctggggctgctgcctgcccactcctggcactgcctctgtgccctggaccgctgctcacgc
atggcacccctgctcagccgctcctatttggccgtctgggctctgtcgagcctgctcgtc
ttcctgctcatggtggcggtctacacccgcattttcttctacgtgcggcggcgagtgcag
cgcatggcagagcatgtcagctgccacccccgctaccgagagaccacactcagcctggtc
aagactgttgtcatcatcctgggggcgttcgtggtctgctggacaccaggccaggtggta
ctgctcctggatggtttaggctgtgagtcctgcaatgtcctggctgtagaaaagtacttc
ctactgttggccgaggccaactcactggtcaatgctgctgtgtactcttgccgagatgct
gagatgcgccgcaccttccgccgcctcctctgctgcgcgtgcctccgccggtccacccgc
gagtctgtccactatacatcctctgcccagggaggtgccagcactcgcatcatgcttccc
gagaacggccacccactgatggactccaccctttag

KEGG   Pongo abelii (Sumatran orangutan): 100458931
Entry
100458931         CDS       T01416                                 

Gene name
LPAR1
Definition
(RefSeq) lysophosphatidic acid receptor 1
  KO
K04289  lysophosphatidic acid receptor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04072  Phospholipase D signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04540  Gap junction
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100458931 (LPAR1)
   04072 Phospholipase D signaling pathway
    100458931 (LPAR1)
   04151 PI3K-Akt signaling pathway
    100458931 (LPAR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100458931 (LPAR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100458931 (LPAR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100458931 (LPAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100458931 (LPAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100458931 (LPAR1)
G protein-coupled receptors [BR:pon04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    100458931 (LPAR1)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 100458931
NCBI-ProteinID: XP_002820139
Ensembl: ENSPPYG00000019495
UniProt: H2PT11
LinkDB
Position
9
AA seq 364 aa
MAAISTSIPVISQPQFAAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVC
IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST
WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA
IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS
RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSND
HSVV
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggctgccatctctacttccatccctgtaatttcacagccccagttcgcagccatgaat
gaaccacagtgcttctacaatgagtccattgccttcttttataaccgaagtggaaagcat
cttgccacagaatggaacacagtcagcaagctggtgatgggacttggaatcactgtttgt
atcttcatcatgttggccaacctgttggtcatggtggcaatctatgtcaaccgccgcttc
cattttcctatttattacctaatggctaatctggctgctgcagacttctttgctgggttg
gcctacttctatctgatgttcaacacaggacccaatactcggagactgactgttagcaca
tggctccttcgtcagggcctcattgacaccagcctgacggcatctgtggccaacttactg
gctattgcaatcgagaggcacattacggttttccgcatgcagctccacacacggatgagc
aaccggagggtagtggtggtcattgtggtcatctggactatggccattgttatgggtgct
atacccagtgtgggctggaactgcatctgtgatattgaaaattgttccaacatggcaccc
ctctacagtgactcttacttagtcttctgggccattttcaacttggtgacctttgtggta
atggtggttctctatgctcacatctttggctatgttcgccagaggactatgagaatgtct
cggcatagttctggaccccggcggaatcgggataccatgatgagtcttctgaagactgtg
gtcattgtgcttggggcctttatcatctgctggactcctggattggttttgttacttcta
gacgtgtgctgtccacagtgcgacgtgctggcctatgagaaattcttccttctccttgct
gaattcaactctgccatgaaccccatcatttactcctaccgcgacaaagaaatgagcgcc
acctttaggcagatcctgtgctgccagcgcagtgagaaccccaccggccccacagaaggc
tcagaccgctcggcttcctccctcaaccacaccatcttggctggagttcacagcaatgac
cactctgtggtttag

KEGG   Pongo abelii (Sumatran orangutan): 100459511
Entry
100459511         CDS       T01416                                 

Gene name
LPAR4
Definition
(RefSeq) lysophosphatidic acid receptor 4
  KO
K04275  lysophosphatidic acid receptor 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04072  Phospholipase D signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100459511 (LPAR4)
   04072 Phospholipase D signaling pathway
    100459511 (LPAR4)
   04151 PI3K-Akt signaling pathway
    100459511 (LPAR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100459511 (LPAR4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100459511 (LPAR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459511 (LPAR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100459511 (LPAR4)
G protein-coupled receptors [BR:pon04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    100459511 (LPAR4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100459511
NCBI-ProteinID: XP_002831883
Ensembl: ENSPPYG00000020500
UniProt: H2PW41
LinkDB
Position
X
AA seq 370 aa
MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVS
LFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLT
NIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTN
VNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQI
GTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLA
TLNCCFDPFIYYFTLESFQKSFYINTHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNN
GGELMLESTF
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgggtgacagaagattcattgacttccaattccaagattcaaattcaagcctcagaccc
aggttgggcaatgctactgccaataatacttgcattgttgatgattccttcaagtataat
ctcaatggtgctgtctacagtgttgtattcatcttgggtctgataaccaacagtgtctct
ctgtttgtcttctgtttccgcatgaaaatgagaagtgagactgctatttttatcaccaat
ctagccgtctctgatttgctttttgtctgtaccctaccttttaaaatattttacaacttc
aaccgccactggccttttggtgacaccctctgcaagatctctggaactgcattccttacc
aacatctacgggagcatgctctttctcacttgtattagtgtggatcgtttcctggccatt
gtctatccttttcgatctcgtactattaggactaggaggaattctgccattgtgtgtgct
ggtgtctggatcctagtcctcagtggcggtatttcggcctctttgttttccaccactaat
gtcaacaatgcaactaccacctgctttgaaggcttctccaaacgtgtctggaagacttat
ttatccaagatcacaatatttattgaagttgttgggtttatcattcctctaatattgaat
gtctcttgctcttctgtggtgctgagaactcttcgcaagcctgctactctgtctcaaatt
gggaccaataagaaaaaagttctgaaaatgatcacagtacatatggcagtctttgtggta
tgctttgtaccctacaactctgtcctcttcctgtatgccctggtgcgctcccaagctatt
actaattgctttttggaaagatttgcaaagatcatgtacccaatcaccttgtgccttgca
actctgaactgttgttttgaccctttcatctattacttcacccttgagtcctttcagaag
tccttctacatcaatacccacatcagaatggagtccctgtttaagactgaaacacctttg
accacaaagccttcccttccagctattcaagaggaggtgagtgatcaaacaacaaataat
ggtggtgaattaatgctagaatccaccttttag

DBGET integrated database retrieval system