KEGG   Pongo abelii (Sumatran orangutan): 100172938
Entry
100172938         CDS       T01416                                 

Gene name
TUBB
Definition
(RefSeq) tubulin beta chain
  KO
K07375  tubulin beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04145  Phagosome
pon04540  Gap junction
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100172938 (TUBB)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100172938 (TUBB)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100172938 (TUBB)
   05012 Parkinson disease
    100172938 (TUBB)
   05014 Amyotrophic lateral sclerosis
    100172938 (TUBB)
   05016 Huntington disease
    100172938 (TUBB)
   05020 Prion disease
    100172938 (TUBB)
   05022 Pathways of neurodegeneration - multiple diseases
    100172938 (TUBB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100172938 (TUBB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100172938 (TUBB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100172938 (TUBB)
   04147 Exosome [BR:pon04147]
    100172938 (TUBB)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     100172938 (TUBB)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    100172938 (TUBB)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100172938 (TUBB)
  Exosomal proteins of colorectal cancer cells
   100172938 (TUBB)
  Exosomal proteins of bladder cancer cells
   100172938 (TUBB)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 100172938
NCBI-ProteinID: NP_001125997
Ensembl: ENSPPYG00000016419
UniProt: Q5R943 A0A2J8SJF9
LinkDB
Position
6
AA seq 444 aa
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEEDFGEEAEEEA
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgagggaaatcgtgcacatccaggctggtcagtgtggcaaccagatcggtgccaagttc
tgggaggtgatcagtgatgaacatggcatcgaccccaccggcacctaccacggggacagc
gacctgcagctggaccgcatctctgtgtactacaatgaagccacaggtggcaaatatgtt
cctcgtgccatcctggtggatctagaacctgggaccatggactctgttcgctcaggtcct
tttggccagatctttagaccagacaactttgtatttggtcagtctggggcaggtaacaac
tgggccaaaggccactacacagagggcgccgagctggttgattctgtcctggatgtcgta
cggaaggaggcagagagctgtgactgcctgcagggcttccagctgacccactcactgggc
gggggcacaggctctggaatgggcactctccttatcagcaagatccgagaagaataccct
gatcgcatcatgaataccttcagtgtggtgccttcacccaaagtgtctgacaccgtggtc
gagccctacaatgccaccctctccgtccatcagttggtagagaacactgatgagacctat
tgcattgacaacgaggccctctatgatatctgcttccgcactctgaagctgaccacacca
acctacggggatctgaaccacctcgtctcagccaccatgagcggtgtcaccacctgcctc
cgtttccctggccagctcaatgctgacctccgcaagttggcagtcaacatggtccccttc
ccacgtctccatttctttatgcctggctttgcccctctcaccagccgtggaagccagcag
tatcgagctctcacagtgccggaactcacccagcaggtcttcgatgccaagaacatgatg
gctgcctgtgacccccgccacggccgatacctcaccgtggctgctgtcttccgtggtcgg
atgtccatgaaggaggtcgatgagcagatgcttaacgtgcagaacaagaacagcagctac
tttgtggaatggatccccaacaatgtcaagacagccgtctgtgacatcccacctcgtggc
ctcaagatggcagtcaccttcattggcaatagcacagccatccaggagctcttcaagcgc
atctcggagcagttcactgccatgttccgccggaaggccttcctccactggtacacaggc
gagggcatggacgagatggagttcaccgaggctgagagcaacatgaacgacctcgtctct
gagtatcagcagtaccaggatgccactgcagaagaggaggaggatttcggtgaggaggcc
gaagaggaggcctaa

KEGG   Pongo abelii (Sumatran orangutan): 100434432
Entry
100434432         CDS       T01416                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: tubulin beta-8 chain
  KO
K07375  tubulin beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04145  Phagosome
pon04540  Gap junction
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100434432
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100434432
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100434432
   05012 Parkinson disease
    100434432
   05014 Amyotrophic lateral sclerosis
    100434432
   05016 Huntington disease
    100434432
   05020 Prion disease
    100434432
   05022 Pathways of neurodegeneration - multiple diseases
    100434432
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100434432
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100434432
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100434432
   04147 Exosome [BR:pon04147]
    100434432
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     100434432
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    100434432
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100434432
  Exosomal proteins of colorectal cancer cells
   100434432
  Exosomal proteins of bladder cancer cells
   100434432
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 100434432
NCBI-ProteinID: XP_002834717
UniProt: H2PXC7
LinkDB
Position
9
AA seq 444 aa
MREIVLTQAGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQLERINVYYNEASGGRYV
PRAVLVDLEPGTMDSVRSGPFGQVFRPDNFIFGQCGAGNNWAKGHYTEGAELMESVMDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPKVSDTVV
EPYNATLSVHQLIENADETFCIDNEALYDICSRTLKLPTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTQQMFDAKNMM
AACDPRHGRYLTAAXIFRGRMPMREVDEQMFNIQDKNSSYFADWLPNNVKTAVCDIPPRG
LKMSATFIGNNTAIQELFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEEFEEDAEEEVA
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgagggagattgtgctcacgcaggccgggcagtgcgggaaccagatcggggccaagttc
tgggaggtgatctctgatgagcacgccatcgactccgctggcacctaccacggggacagc
cacctacagctggagcgcatcaacgtgtactacaacgaggccagcggtggcaggtacgtg
ccccgcgctgtgctggtggatctggagccgggcactatggactctgtgcgctcggggccc
ttcgggcaggtcttcaggccagataatttcatcttcggtcagtgtggggccggaaacaac
tgggccaagggacactacacagaaggtgcggagctgatggagtcagtgatggacgtcgtc
agaaaggaggctgagagctgtgactgcctgcagggtttccagctgacccactccctgggt
ggggggacggggtctgggatgggcacccttctgctcagtaagatccgggaggagtaccca
gacaggatcataaacacattcagcatcctgccctcgcccaaggtgtcggacaccgtggtg
gagccctacaacgccaccctctcagtccaccagctcatagagaacgcggatgagaccttc
tgcatagataacgaagcgctgtatgacatatgttccaggaccctaaagctgcccacaccc
acctatggtgacctgaaccacctggtgtctgcgaccatgagtggggtcaccacgtgcctg
cgcttcccaggccagctgaatgccgacctgcggaagctggccgtgaacatggtcccgttt
ccccggctgcacttcttcatgcccggcttcgccccactgaccagccggggcagccagcag
taccgggccttgaccgtggctgagctcacccagcagatgtttgatgctaaaaacatgatg
gcggcctgcgacccccgccatggccgctacctgacggcggccnccattttcaggggtcgc
atgcccatgagggaggtggatgaacagatgttcaacattcaagataagaacagcagctac
tttgctgactggctccccaacaacgtaaaaacagccgtctgtgacatcccaccccggggg
ctgaaaatgtcggccaccttcattgggaacaacacagccatccaggaactcttcaggcgt
gtctcagagcagtttacagcaatgttcaggcgcaaggccttcctccactggtacacgggc
gagggcatggatgagatggaattcactgaggccgagagcaacatgaatgacctggtgtct
gaatatcagcaatatcaggatgccacggccgaggaggaggagtttgaggaggatgctgag
gaggaggtggcctag

KEGG   Pongo abelii (Sumatran orangutan): 100438882
Entry
100438882         CDS       T01416                                 

Gene name
TUBB4B
Definition
(RefSeq) tubulin beta-4B chain
  KO
K07375  tubulin beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04145  Phagosome
pon04540  Gap junction
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100438882 (TUBB4B)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100438882 (TUBB4B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100438882 (TUBB4B)
   05012 Parkinson disease
    100438882 (TUBB4B)
   05014 Amyotrophic lateral sclerosis
    100438882 (TUBB4B)
   05016 Huntington disease
    100438882 (TUBB4B)
   05020 Prion disease
    100438882 (TUBB4B)
   05022 Pathways of neurodegeneration - multiple diseases
    100438882 (TUBB4B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100438882 (TUBB4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100438882 (TUBB4B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100438882 (TUBB4B)
   04147 Exosome [BR:pon04147]
    100438882 (TUBB4B)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     100438882 (TUBB4B)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    100438882 (TUBB4B)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100438882 (TUBB4B)
  Exosomal proteins of colorectal cancer cells
   100438882 (TUBB4B)
  Exosomal proteins of bladder cancer cells
   100438882 (TUBB4B)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 100438882
NCBI-ProteinID: XP_024108141
LinkDB
Position
9
AA seq 445 aa
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEFEEEAEEEVA
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgagggaaatcgtgcacctgcaggccgggcagtgcggcaaccaaatcggcgccaagttt
tgggaggtgatcagcgatgagcacggcatcgaccccacgggcacctaccacggggacagc
gatctgcagctggagcgcatcaacgtgtactacaacgaggccaccggcggcaagtacgtg
ccccgcgccgtgctcgtggatctggagcccggcaccatggactccgtgcgctcggggccc
ttcgggcagatcttccggccggacaacttcgttttcggtcagagtggtgctgggaacaac
tgggccaaggggcactacacagaaggcgcggagctggtggactcggtgctggatgttgtg
aggaaggaggctgagagctgtgactgcctgcagggtttccagctgacccactccctgggt
ggggggactgggtctgggatgggtaccctcctcatcagcaagatccgggaggagtaccca
gacaggatcatgaacacgttcagtgtggtgccttcgcccaaggtgtcagacacagtggtg
gagccctacaacgccaccctctcagtccatcagctcgtagaaaacacagatgagacctac
tgcattgataatgaagctctctacgacatttgcttcagaaccctaaagctgaccacaccc
acctatggtgacctgaaccacctggtgtctgctaccatgagtggggtcaccacctgcctg
cgcttcccaggccagctcaatgctgacctgcggaagctggctgtgaacatggtcccattc
ccccgcctgcacttcttcatgcccggctttgccccactgaccagccggggcagccagcag
taccgggcgctgaccgtacctgagctcacccagcagatgtttgatgctaaaaacatgatg
gcggcctgcgacccccgccatggccgctacctgacggttgccgccgtgttcaggggccgc
atgtccatgaaggaggtggatgagcaaatgcttaatgtccaaaacaaaaacagcagctat
tttgttgagtggatccccaacaatgtgaaaacagctgtctgtgacatcccgcctcggggg
ctaaaaatgtctgccaccttcatcggcaacagcacggccatccaggagctgttcaagcgc
atctccgagcagttcacggccatgttccggcgcaaggccttcctgcactggtatacgggc
gagggcatggacgagatggagttcactgaagccgagagcaacatgaatgacctggtgtcc
gagtaccagcagtaccaggatgccacagccgaggaggagggcgagttcgaggaggaggct
gaggaggaggtggcctag

KEGG   Pongo abelii (Sumatran orangutan): 100441382
Entry
100441382         CDS       T01416                                 

Definition
(RefSeq) uncharacterized protein LOC100441382
  KO
K07375  tubulin beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04145  Phagosome
pon04540  Gap junction
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100441382
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100441382
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100441382
   05012 Parkinson disease
    100441382
   05014 Amyotrophic lateral sclerosis
    100441382
   05016 Huntington disease
    100441382
   05020 Prion disease
    100441382
   05022 Pathways of neurodegeneration - multiple diseases
    100441382
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100441382
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100441382
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100441382
   04147 Exosome [BR:pon04147]
    100441382
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     100441382
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    100441382
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100441382
  Exosomal proteins of colorectal cancer cells
   100441382
  Exosomal proteins of bladder cancer cells
   100441382
SSDB
Motif
Pfam: Tubulin Tubulin_C 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 100441382
NCBI-ProteinID: XP_009249349
Ensembl: ENSPPYG00000007678
UniProt: H2NRV0
LinkDB
Position
16
AA seq 1150 aa
MTPSCFLDRTMAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGAWCLEVSIPDGLFLSLGL
VSLVENVLVVATIAKNRNLHSPMYCFICCLALSDLLVSGGNVLETAVILLLEAGALAARA
AVVQQLDNVIDVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAIAAIWV
ASVLFSTLFIAYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRP
VHQGFGLKGAVTLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLALIICN
AIIDPLIYAFRSQELRRTLKEVLTCSWLNGGCRAAISRLLGRLSQQPPGQPHPCFSSSPD
CRLQDWELLPGRARLCWETGRKRISSRSPSPPCTQSPTSESESERSRCPPSPTLAGFLPG
LCVLVTIPDTDAHRAVARPGAVRARAHKAPLESHGSPLVEGVRCPPTHCGSRRPTELALG
RRHPSVSAPFRALIGCFVSSQWVQGLRQPLPTSPTQNRQSSEHLVCQKTGRWEGAGWSLN
RRGEKRPSLQSRRVGLSQGRNRDGSWGRGSQGQEGLLSSLEPGAPTASSSGRQPLLSSAQ
GPQTAPGPALGDPWLREGRRIARGGRGRAVPSMRAGTRGAEPAGRAGFCGGASRLATRGD
ISRCEGRGRSYKSARPRSPTLSSQPGPPAPVRSRSPDAPSMREIVHIQAGQCGNQIGAKF
WEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGA
FGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLG
GGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETY
CIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPF
PRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGR
MSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKR
ISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDD
EEESEAQGPK
NT seq 3453 nt   +upstreamnt  +downstreamnt
atgaccccttcctgcttcctggacaggactatggctgtgcagggatcccagagaagactc
ctgggctccctcaactccacccccacagccatcccccagctggggctggctgccaaccag
acaggagcctggtgcctggaggtgtccatacctgacgggctcttcctcagcctggggctg
gtgagcttggtggagaacgtgctggtggtggccaccatcgccaagaaccggaacctgcac
tcacccatgtactgcttcatctgctgcctggccctgtcggacctgctggtgagcgggggc
aacgtgctggagacggccgtcatcctcctgctggaggccggtgcgctggcggcccgggct
gccgtggtgcagcagctggacaatgtcattgatgtgatcacctgcagctccatgctgtcc
agcctctgcttcctgggcgccatcgccgtggaccgctacatctccatcttctacgcgctg
cgctaccacagcatcgtgacgctgccgcgggcacggcgagccatcgcggccatctgggtg
gccagtgtcctcttcagcacgctcttcattgcctactacgaccacgcggccgtcctgctg
tgccttgtggtctttttcctggccatgctggtgctcatggccgtgctgtacgtccacatg
ctggcccgggcctgccagcacgcccagggcatcgcccggctccacaagaggcagcgcccg
gtccaccaaggctttggccttaaaggcgctgtcaccctcaccatcctgctgggcattttc
ttcctctgctggggccccttctttctgcatctcacactcatcgtcctctgcccccagcac
cccacgtgcagctgcatcttcaagaacttcaacctctttctcgccctcatcatctgcaat
gccatcatcgaccccctcatctacgccttccgcagccaggagctccgcaggacgctcaag
gaggtgctgacatgctcctggctcaatggaggctgcagggccgccatcagccgactccta
ggcaggctcagtcagcagccccctggccagccccacccctgcttcagctccagccctgac
tgccggcttcaggactgggagctgcttcctggcagggcccgcctctgctgggagaccgga
cgtaaacgcatctccagtcgttcccccagtcccccctgcacgcagtctccgacctcagag
agtgagtcagaaagaagccgctgcccaccttcccccaccctggccgggttcttgcctggc
ttgtgcgtccttgtgacaattcctgacaccgatgcgcaccgggcagtggcacgtccaggt
gctgtgcgcgcccgggcccacaaagctcctttggagtctcatggcagccccttggtggag
ggggtcaggtgcccccccacccactgcggaagccggcgacccacggagctcgctctcggc
cgccgccacccctctgtgtccgcgcccttccgagctctgatcggatgctttgtttcttct
cagtgggttcagggcctgcgccagcctttacctacctcccccacccaaaaccggcaaagc
tcagagcaccttgtctgccaaaagacagggaggtgggaaggtgcgggttggtctctaaac
cggcgtggggaaaaaagaccctccttacaaagccgcagggtggggctgtcgcaagggcgg
aaccgagatggtagctgggggcggggttcccagggccaagaggggctattgtcctccctg
gagcccggcgcccccacagccagctcctctgggaggcagcccctcctttcgagtgcgcag
ggcccccagaccgcgcccggcccagcgctgggggatccttggctgcgggaggggcgccgc
attgcgcgcggcgggcggggacgcgcggtgccgagcatgcgggcggggacgcgcggtgcg
gagcctgcgggccgggcggggttctgcggcggcgcctcccgattggccactcgcggtgac
atcagccgatgcgaagggcggggccgcagctataagagcgcgcggccgcggtccccgacc
ctcagcagccagcccggcccgcccgcgcccgtccgcagccgctcgccagacgcgcccagt
atgagggagatcgtgcacatccaggccggccagtgcggcaaccagatcggggccaagttc
tgggaagtcatcagtgatgagcatggcatcgaccccagcggcaactacgtgggcgactcg
gacttgcagctggagcggatcagcgtctattacaacgaggcctcttctcacaagtacgtg
cctcgggccattctggttgacctggaacccggaacgatggacagcgtccgctcaggggcc
ttcggacatcttttcaggcctgacaatttcatctttggtcagagtggggccggcaacaac
tgggccaagggtcactacacagagggtgcggagctggtggattccgtcctggatgtcgtg
cggaaggagtgtgaaaactgcgactgcctgcagggcttccagctgacccactcgctgggg
ggcggcacgggctccggcatgggcacgttgctcatcagcaaggtgcgtgaggagtatccc
gaccgcatcatgaacaccttcagcgtcgtgccctcgcccaaggtgtcagacacggtggtg
gagccctacaacgccacgctgtccatccaccagctggtggagaatacggatgagacctac
tgcatcgacaacgaggcgctctacgacatctgcttccgcaccctcaagctggccacaccc
acctacggggacctcaaccacctggtgtcggccaccatgagcggagtcaccacctccttg
cgcttcccaggccagctcaacgctgacctgcgcaagctggcggtgaacatggtgcccttc
ccgcgtctgcacttcttcatgcccggcttcgcccccctcacagcccggggcagccagcag
taccgggccctgaccgtgcccgagctcacccagcagatgtttgatgccaagaacatgatg
gccgcctgcgacccgcgccacggccgctacctgacggtggccaccgtgttccggggccgc
atgtccatgaaggaggtggacgagcagatgctggccatccagagcaagaacagcagctac
ttcgtggagtggatccccaacaacgtgaaggtggccgtgtgtgacatcccgccccgcggc
cttaagatgtcctccaccttcatcgggaacagcacggccatccaggagctgttcaagcgc
atctccgagcagttcacggccatgttccggcgcaaggccttcctgcactggtacacgggc
gagggcatggacgagatggagttcaccgaggccgagagcaacatgaacgacctggtgtcc
gagtaccagcagtaccaggacgccacggccgaggaggagggcgagatgtacgaagacgac
gaggaggagtcggaggcccagggccccaagtga

KEGG   Pongo abelii (Sumatran orangutan): 100443487
Entry
100443487         CDS       T01416                                 

Gene name
TUBB1
Definition
(RefSeq) tubulin beta-1 chain isoform X1
  KO
K07375  tubulin beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04145  Phagosome
pon04540  Gap junction
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100443487 (TUBB1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100443487 (TUBB1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100443487 (TUBB1)
   05012 Parkinson disease
    100443487 (TUBB1)
   05014 Amyotrophic lateral sclerosis
    100443487 (TUBB1)
   05016 Huntington disease
    100443487 (TUBB1)
   05020 Prion disease
    100443487 (TUBB1)
   05022 Pathways of neurodegeneration - multiple diseases
    100443487 (TUBB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100443487 (TUBB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100443487 (TUBB1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100443487 (TUBB1)
   04147 Exosome [BR:pon04147]
    100443487 (TUBB1)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     100443487 (TUBB1)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    100443487 (TUBB1)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100443487 (TUBB1)
  Exosomal proteins of colorectal cancer cells
   100443487 (TUBB1)
  Exosomal proteins of bladder cancer cells
   100443487 (TUBB1)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_2 Tubulin_3
Other DBs
NCBI-GeneID: 100443487
NCBI-ProteinID: XP_002830519
Ensembl: ENSPPYG00000011180
LinkDB
Position
20
AA seq 453 aa
MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDCGASALQLERISVYYNEAYGRKYV
PRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVV
RHESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSDTVV
EPYNAVLSIHQLIENADACFCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGITTSL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQYRALSVAELTQQMFDARNTM
AACDPRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVKVAVCDIPPRG
LSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAESNIHDLVS
EYQQFQDAKAVLEEDEEGMEEAEMEPEDKGHSP
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgcgtgaaattgtccatattcagattggccagtgtggcaaccagatcggagccaagttc
tgggagatgattggtgaggaacatgggattgacttggctgggagcgactgcggggcctcg
gccttgcagctggagagaatcagcgtgtactacaacgaagcctatggtaggaaatatgtg
ccccgagcagtcttggtggacctagaacctgggacgatggacagcattcgatctagcaaa
ttaggagccctctttcaacccgacagttttgtccatggtaactctggggctggcaataac
tgggccaaaggccactacacggagggagctgagctgatcgagaacgtcctagaggtggtg
aggcacgagagtgagagctgcgactgcctgcagggcttccagatcgtccactccctgggc
gggggcacaggctccgggatgggcactctgctcatgaacaagattagagaggagtacccg
gaccggatcatgaattccttcagtgtcatgccttctcccaaggtgtcggacacggtggtg
gagccctacaatgcggttctgtccatccaccagctgattgagaatgcagatgcctgtttc
tgcattgacaatgaggccctctatgacatctgcttccgtaccctgaagctgacgacaccc
acctacggggatctcaaccacctagtgtccttgaccatgagtggcataaccacctccctc
cggttcccgggtcagctcaacgcagacctgcgcaagctggcggtgaacatggtccccttc
ccccgcctgcacttctttatgcccggctttgccccactcacggcccagggcagccagcag
taccgagccctctccgtggccgagctcacccagcagatgtttgatgcccgcaataccatg
gctgcctgtgacccccgccgtggccgctacctcacagtggcctgcattttccggggcaag
atgtccaccaaggaagtggaccagcaactgctctccgtgcagaccaggaacagcagctgc
tttgtggagtggattcccaataatgtcaaggtggctgtctgcgacatcccgccccggggg
ctgagcatggccgccaccttcattggcaacaacacggccatccaagagatctttaatagg
gtctctgagcatttctcagccatgttcaaaaggaaagcttttgtgcactggtacaccagc
gaagggatggacataaacgaatttggggaagctgaaagtaacatccatgatttggtatcc
gagtaccaacaatttcaagatgccaaagcagttctagaggaagatgaagagggcatggag
gaggcagaaatggagccagaagataagggacattcaccgtga

KEGG   Pongo abelii (Sumatran orangutan): 100443594
Entry
100443594         CDS       T01416                                 

Gene name
TUBB4A
Definition
(RefSeq) tubulin beta-4A chain
  KO
K07375  tubulin beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04145  Phagosome
pon04540  Gap junction
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100443594 (TUBB4A)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100443594 (TUBB4A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100443594 (TUBB4A)
   05012 Parkinson disease
    100443594 (TUBB4A)
   05014 Amyotrophic lateral sclerosis
    100443594 (TUBB4A)
   05016 Huntington disease
    100443594 (TUBB4A)
   05020 Prion disease
    100443594 (TUBB4A)
   05022 Pathways of neurodegeneration - multiple diseases
    100443594 (TUBB4A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100443594 (TUBB4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100443594 (TUBB4A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100443594 (TUBB4A)
   04147 Exosome [BR:pon04147]
    100443594 (TUBB4A)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     100443594 (TUBB4A)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    100443594 (TUBB4A)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100443594 (TUBB4A)
  Exosomal proteins of colorectal cancer cells
   100443594 (TUBB4A)
  Exosomal proteins of bladder cancer cells
   100443594 (TUBB4A)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 100443594
NCBI-ProteinID: XP_009250948
LinkDB
Position
19
AA seq 444 aa
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRG
LKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEGEFEEEAEEEVA
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgcgggagatcgtgcacctgcaggccggccagtgcggcaaccagatcggggccaagttt
tgggaggttatcagtgacgaacatggcatcgaccccacaggcacatatcatggggacagt
gacctgcaactggagaggatcaacgtgtactacaacgaggccacaggaggaaattatgtc
cccagagcggtgctggtggacctggaacccggcaccatggactctgtccgttccggcccc
ttcggtcagatctttcggccggacaacttcgtgtttggccaatccggagccggcaacaac
tgggcaaaggggcactacacggagggcgcagagctggtggacgctgtcctggacgtagtc
cggaaggaggccgagagctgcgactgccttcagggcttccagctgacccactcgctgggg
ggtggcacggggtccgggatgggcacgctgctcatcagtaagatccgcgaggagttccca
gaccgcatcatgaacaccttcagtgtggtgccctcgcccaaagtgtcagacacggtggtg
gagccctacaacgccacgctgtctgtgcaccaactggtggagaatacggatgagacctac
tgcatcgacaacgaggcgctctacgacatctgtttccgcaccctcaagctgaccaccccc
acctacggggacctcaaccacctggtgtcggccaccatgagcggggtcaccacctgcctg
cgcttcccgggccagctgaacgccgacctgcgcaagctggccgtcaacatggtccccttt
cctcgcctgcacttcttcatgcccggcttcgcacccctgaccagccggggcagccagcag
taccgggccctgacggtgcccgagctcacccagcagatgttcgacgccaagaacatgatg
gcggcgtgcgacccgcgccacggccgctacctgaccgtggctgccgtgttccggggccgc
atgtccatgaaggaggtggacgagcagatgctgagcgtgcagagcaagaacagcagctac
ttcgtggagtggatccccaacaatgtgaagacggccgtgtgcgacatcccgccccgcggc
ctgaagatggccgcgaccttcatcggcaacagcacggccatccaggagctgttcaagcgc
atctccgagcagttcacggccatgttccggcgcaaggccttcttgcactggtacacgggc
gagggcatggacgagatggagttcaccgaggccgagagcaacatgaatgacctggtatct
gagtaccagcagtaccaggacgccacggccgaggagggcgagttcgaggaggaggcggag
gaggaggtggcctag

KEGG   Pongo abelii (Sumatran orangutan): 100448146
Entry
100448146         CDS       T01416                                 

Gene name
TUBB6
Definition
(RefSeq) tubulin beta-6 chain isoform X1
  KO
K07375  tubulin beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04145  Phagosome
pon04540  Gap junction
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100448146 (TUBB6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100448146 (TUBB6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100448146 (TUBB6)
   05012 Parkinson disease
    100448146 (TUBB6)
   05014 Amyotrophic lateral sclerosis
    100448146 (TUBB6)
   05016 Huntington disease
    100448146 (TUBB6)
   05020 Prion disease
    100448146 (TUBB6)
   05022 Pathways of neurodegeneration - multiple diseases
    100448146 (TUBB6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100448146 (TUBB6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100448146 (TUBB6)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100448146 (TUBB6)
   04147 Exosome [BR:pon04147]
    100448146 (TUBB6)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     100448146 (TUBB6)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    100448146 (TUBB6)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100448146 (TUBB6)
  Exosomal proteins of colorectal cancer cells
   100448146 (TUBB6)
  Exosomal proteins of bladder cancer cells
   100448146 (TUBB6)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 100448146
NCBI-ProteinID: XP_003778983
Ensembl: ENSPPYG00000008991
UniProt: A0A6D2WZ03 H2NVT3
LinkDB
Position
18
AA seq 446 aa
MREIVHIQAGQCGNQIGTKFWEVISDEHGIDPAGGYVGDSALQLERISVYYNESSSQKYV
PRAALVDLEPGTMDSVRSGPFGQLFRPDNFIFGQTGAGNNWAKGHYTEGAELVDAVLDVV
RKECEHCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVMPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTSL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDARNMM
AACDPRHGRYLTVATVFRGPMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRG
LKMASTFIGNSTAIQELFKRISEQFSAMFRRKAFLHWFTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATANDGEEAFEDEEEEIDG
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgagggagattgtgcacatccaggcgggccagtgcgggaaccagatcggcaccaagttt
tgggaagtgataagcgatgagcacggcatcgacccggccggaggctacgtgggagactcg
gcgctgcagctggagagaatcagcgtctactacaatgagtcatcgtctcagaaatatgtg
cccagggccgccttggtggacttagagccaggcaccatggacagcgtgcggtccgggcct
tttgggcagcttttccggcctgacaacttcatctttggccagacgggcgcagggaacaac
tgggcgaaggggcactacacggagggcgcggagctggtggacgcagtgctggacgtggtg
cggaaggagtgcgagcactgcgactgcctgcagggcttccagctcacgcactcgctgggc
ggcggcacgggctcgggcatgggcacgctgctcatcagcaagatccgtgaggagttcccg
gaccgcatcatgaacaccttcagcgtcatgccctcgcccaaggtgtcggacacggtggtg
gagccctacaatgccacgttgtcggtgcaccagctggtggagaatacagacgagacctac
tgcatcgacaacgaggccctctacgacatctgcttccgcaccctgaagctgacaacgccc
acctacggggacctcaaccacctggtgtctgccaccatgagtggggtcaccacctcgctg
cgcttcccgggccagctcaatgctgacctgcgcaagctggcggtgaacatggtgcccttc
ccgcgcctgcacttcttcatgcctggcttcgcgccgctcaccagccgcggcagccagcag
taccgggccctgaccgtgcccgagctcacccagcagatgttcgacgccaggaacatgatg
gccgcctgcgacccgcgccatggccgctacttgaccgtggccaccgtgttccgcgggccc
atgtccatgaaggaggtggacgagcagatgctggccatccagagtaagaacagcagctac
ttcgtggagtggatccccaacaacgtgaaggtggccgtgtgcgacatcccgccccgcggc
ctgaagatggcctccaccttcatcggcaatagcacggccatccaggagctgttcaagcgc
atctccgagcagttctcagccatgttccggcgcaaggccttcctgcactggttcacgggt
gagggcatggatgagatggagttcaccgaggccgagagcaacatgaacgacctggtatcc
gagtaccagcagtaccaggatgccaccgccaatgacggggaggaagcttttgaggatgag
gaagaggagatcgatggatag

KEGG   Pongo abelii (Sumatran orangutan): 100450699
Entry
100450699         CDS       T01416                                 

Gene name
TUBB2A
Definition
(RefSeq) tubulin beta-2A chain
  KO
K07375  tubulin beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04145  Phagosome
pon04540  Gap junction
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100450699 (TUBB2A)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100450699 (TUBB2A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100450699 (TUBB2A)
   05012 Parkinson disease
    100450699 (TUBB2A)
   05014 Amyotrophic lateral sclerosis
    100450699 (TUBB2A)
   05016 Huntington disease
    100450699 (TUBB2A)
   05020 Prion disease
    100450699 (TUBB2A)
   05022 Pathways of neurodegeneration - multiple diseases
    100450699 (TUBB2A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100450699 (TUBB2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100450699 (TUBB2A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100450699 (TUBB2A)
   04147 Exosome [BR:pon04147]
    100450699 (TUBB2A)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     100450699 (TUBB2A)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    100450699 (TUBB2A)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100450699 (TUBB2A)
  Exosomal proteins of colorectal cancer cells
   100450699 (TUBB2A)
  Exosomal proteins of bladder cancer cells
   100450699 (TUBB2A)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 100450699
NCBI-ProteinID: XP_002816407
UniProt: A0A2J8WML0
LinkDB
Position
6
AA seq 445 aa
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVV
EPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMM
AACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEQGEFEEEEGEDEA
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgcgcgagatcgtgcacatccaggcgggccagtgcggcaaccagatcggcgccaagttt
tgggaggtcatcagcgatgagcatgggatcgaccctacaggcagttaccatggagacagt
gacttgcagctggagagaatcaacgtgtactacaatgaggctgctggtaacaaatatgta
cctcgggccatcctggtggatctggagcctggcaccatggactccgtcaggtctggaccc
ttcggccagatcttcaggccagacaacttcgtgtttggccagagtggagccgggaataac
tgggccaagggccactacacagagggagccgagctggtcgactcggtcctggatgtggtg
aggaaggagtcagagagctgtgactgtctccagggcttccagctgacccactctctgggg
ggcggcacggggtccgggatgggcaccctgctcatcagcaagatccgggaagagtaccca
gaccgcatcatgaacaccttcagcgtcatgccctcacccaaggtgtcagacacggtggtg
gagccctacaacgccaccctctctgtccaccagctggtggaaaacaccgatgaaacgtac
tccattgacaacgaggccctgtatgacatctgcttccgcaccctgaagctgaccaccccc
acctacggggacctcaaccacctggtgtcggccaccatgagcggggtcaccacctgcctg
cgcttcccgggccagctgaacgcagacctgcgcaagctggcggtgaacatggtgcccttc
ccccgcctgcacttcttcatgcccggcttcgcgcccctgaccagccggggcagccagcag
taccgggcgctcacggtgcccgagctcacccagcagatgttcgactccaagaacatgatg
gccgcctgcgacccgcgccacggccgctacctgacggtggccgccatcttccggggccgc
atgtccatgaaggaggtggacgagcagatgctcaacgtgcagaacaagaacagcagctac
ttcgtggagtggatccccaacaacgtgaagacggccgtgtgcgacatcccgccccgcggc
ctgaagatgtcggccaccttcatcggcaacagcacggccatccaggagctgttcaagcgc
atctcggagcagttcacggccatgttccggcgcaaggccttcctgcactggtacacgggc
gagggcatggacgagatggagttcaccgaggccgagagcaacatgaacgacctggtgtct
gagtaccagcagtaccaggacgccacggccgacgaacagggggagttcgaggaggaggag
ggtgaggacgaggcttaa

KEGG   Pongo abelii (Sumatran orangutan): 100452363
Entry
100452363         CDS       T01416                                 

Gene name
TUBB8
Definition
(RefSeq) LOW QUALITY PROTEIN: tubulin beta-8 chain
  KO
K07375  tubulin beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04145  Phagosome
pon04540  Gap junction
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100452363 (TUBB8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100452363 (TUBB8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100452363 (TUBB8)
   05012 Parkinson disease
    100452363 (TUBB8)
   05014 Amyotrophic lateral sclerosis
    100452363 (TUBB8)
   05016 Huntington disease
    100452363 (TUBB8)
   05020 Prion disease
    100452363 (TUBB8)
   05022 Pathways of neurodegeneration - multiple diseases
    100452363 (TUBB8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100452363 (TUBB8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100452363 (TUBB8)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100452363 (TUBB8)
   04147 Exosome [BR:pon04147]
    100452363 (TUBB8)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     100452363 (TUBB8)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    100452363 (TUBB8)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100452363 (TUBB8)
  Exosomal proteins of colorectal cancer cells
   100452363 (TUBB8)
  Exosomal proteins of bladder cancer cells
   100452363 (TUBB8)
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 100452363
NCBI-ProteinID: XP_024109616
LinkDB
Position
10
AA seq 370 aa
MDSVRSGPFGQVFRPDNFIFGQCGAGNNWAKGHYTEGAELMESVMDVVRKEAENCDCLQG
FQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPKVSDTVVEPYNATLSVHQL
IENADETFCIDNEALYDICSRTLKLPTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRK
LAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTRQMFDAKNMMAACDPRHGRYLT
XAPFSGSQPMREVDEQMFNIQDKNSSYFADWLPNVKTAVCDIPPRGLKMSATFIGNNTAT
QELFKRVSEQFTAMLRRKAFLHWYTGEGMDEMEFTEAESNMNDLMSEYQQYQDATAEEEE
FEEDAEEEVA
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggactctgtgcgctcggggcccttcgggcaggtcttcaggccagataatttcatcttc
ggtcagtgtggggccggaaacaactgggccaagggacactacacagaaggcgcggagctg
atggagtcagtgatggacgtcgtcagaaaggaggctgagaactgtgactgcctgcagggt
ttccagctgacccactccctgggtggggggactgggtctgggatgggtacccttctgctc
agtaagatccgggaggagtacccagacaggatcataaacacattcagcatcctgccctcg
cccaaggtgtcggacaccgtggtggagccctacaacgccaccctctcagtccaccagctc
atagaaaacgcggatgagaccttctgcatagataacgaagcgctgtatgacatatgttcc
aggaccctaaagctgcccacacccacctatggtgacctgaaccacctggtgtctgcgacc
atgagtggggtcaccacgtgcctgcgcttcccaggccagctgaatgccgacctgcggaag
ctggccgtgaacatggtcccgtttccccggctgcatttcttcatgcccggcttcgcccca
ctgaccagccggggcagccagcagtaccgggccttgaccgtggctgagctcacccggcag
atgtttgatgctaagaacatgatggcggcctgcgacccccgccacggccgctacctgacg
ncggccccattttcagggtcgcagcccatgagggaggtggatgaacagatgttcaacatt
caagataagaacagcagctactttgctgactggctccccaacgtgaaaacagccgtctgt
gacatcccaccccgggggctgaaaatgtcggccaccttcattgggaataacacagccacc
caggaactcttcaagcgtgtctcagagcagtttacagcaatgctcaggcgcaaggccttc
ctccactggtacacgggcgagggcatggatgagatggaattcactgaggccgagagcaac
atgaatgacctgatgtctgaatatcagcaatatcaggatgccacggccgaggaagaggag
tttgaggaggatgctgaggaggaggtggcctag

KEGG   Pongo abelii (Sumatran orangutan): 100452448
Entry
100452448         CDS       T01416                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: tubulin beta-2B chain
  KO
K07375  tubulin beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04145  Phagosome
pon04540  Gap junction
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100452448
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100452448
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100452448
   05012 Parkinson disease
    100452448
   05014 Amyotrophic lateral sclerosis
    100452448
   05016 Huntington disease
    100452448
   05020 Prion disease
    100452448
   05022 Pathways of neurodegeneration - multiple diseases
    100452448
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100452448
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100452448
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100452448
   04147 Exosome [BR:pon04147]
    100452448
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     100452448
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    100452448
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100452448
  Exosomal proteins of colorectal cancer cells
   100452448
  Exosomal proteins of bladder cancer cells
   100452448
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 100452448
NCBI-ProteinID: XP_002816411
Ensembl: ENSPPYG00000016180
UniProt: H2PHS4
LinkDB
Position
6
AA seq 445 aa
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMM
AACDPRHGRYLTVAAIFRGRXSMKEVDEQMLNVQNKNSSYXVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEQGEFEEEEGEDEA
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgcgtgagatcgtgcacatccaggcgggccagtgcggcaaccagattggcgccaagttt
tgggaggtcatcagtgatgagcatgggattgaccccactggcagttaccatggagacagt
gatttgcagctggagagaatcaatgtttactacaatgaagccactggtaacaaatatgtt
cctcgggccatcctcgtggatctggagccaggcacgatggattcggttaggtctggacca
ttcggccagatctttagaccagacaatttcgtgtttggccagagtggagctgggaataac
tgggccaagggccactacacagagggagccgagctggtcgactcggtcctggatgtggtg
aggaaggagtcagagagctgtgactgtctccagggcttccagctgacccactctctgggg
ggcggcacggggtccgggatgggcaccctgctcatcagcaagatccgggaagagtaccca
gaccgcatcatgaacaccttcagcgtcatgccctcacccaaggtgtcagacacggtggtg
gagccctacaacgccaccctctctgtccaccagctggtggaaaacaccgatgaaacctac
tgcattgacaacgaggccctgtatgacatctgcttccgcaccctgaagctgaccaccccc
acctacggggacctcaaccacctggtgtcggccaccatgagcggggtcaccacctgcctg
cgcttcccgggccagctgaacgcagacctgcgcaagctggcggtgaacatggtgcccttc
ccccgcctgcacttcttcatgcctggcttcgcgcccctgaccagccggggcagccagcag
taccgggcgctcacggtgcccgagctcacccagcagatgttcgactccaagaacatgatg
gccgcctgcgacccgcgccacggccgctacctgacggtggccgccatcttccggggccga
ntgtccatgaaggaggtggacgagcagatgctcaacgtgcagaacaagaacagcagctat
ntcgtggagtggatccccaacaacgtgaagacggccgtgtgcgacatcccgccccgcggc
ctgaagatgtcggccaccttcatcggcaacagcacggccatccaggagctgttcaagcgc
atctcggagcagttcacggccatgttccggcgcaaggccttcctgcactggtacacgggc
gagggcatggacgagatggagttcaccgaggccgagagcaacatgaacgacctggtgtct
gagtaccagcagtaccaggacgccacggccgacgaacagggggagttcgaggaggaggag
ggcgaggacgaggcgtag

KEGG   Pongo abelii (Sumatran orangutan): 100452886
Entry
100452886         CDS       T01416                                 

Definition
(RefSeq) tubulin beta-8 chain-like isoform X7
  KO
K07375  tubulin beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04145  Phagosome
pon04540  Gap junction
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100452886
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100452886
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100452886
   05012 Parkinson disease
    100452886
   05014 Amyotrophic lateral sclerosis
    100452886
   05016 Huntington disease
    100452886
   05020 Prion disease
    100452886
   05022 Pathways of neurodegeneration - multiple diseases
    100452886
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100452886
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100452886
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100452886
   04147 Exosome [BR:pon04147]
    100452886
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     100452886
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    100452886
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100452886
  Exosomal proteins of colorectal cancer cells
   100452886
  Exosomal proteins of bladder cancer cells
   100452886
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 100452886
NCBI-ProteinID: XP_002809294
Ensembl: ENSPPYG00000000065
LinkDB
Position
1
AA seq 440 aa
MREIVLTQTGQCGNRIGAKFWEVISDEHAIDSAGTYRGDRDLLLKRINVYYNEASVSRYV
PHAVLVDLEPGTLDSVRSGPFGKIFRPDNFILGQSGARNTWAKGYYTEGTELMESVMDTV
RQEAESCDCLQGFQLAHSLGGGTGSGMGTLLLSKIQEEYPDRIINTFSVLPSPKVPDTMV
EPYNAILSIHQLIENAHETFCIDNKALYNICSRTLQLPRSTYGDLNHMVSATMSGVTTCL
RFPGQLNADLWKLAVNMVSFPRLHFFMPSFAPLTSRGSRQYQALTVAELIQEMFDAKNMT
AACDPRRGCYLTVGAIFRGHMSMKEVDEQMLNLQKNSSHFAYRLPHNVKTATCDIPSKGL
EIWATGISNNTAIQELFKRTMERFTAMFRHKAFLHWYTGEGMDEMEFTEAESNLKNLMAE
YQDATAKEEEFEESAEEEVA
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgagggagattgtgctcacgcagacagggcagtgcgggaaccggatcggcgccaagttc
tgggaggtgatctctgatgaacatgccatcgactccgctggcacctaccgcggggacagg
gacctgctgctgaagcgtatcaacgtatactacaatgaggccagcgttagcaggtatgtg
ccccacgctgtgctagttgatctggagccgggcaccctggactccgtgcgctccgggccc
ttcgggaagatcttcaggccggacaacttcatcttgggtcagagtggggccaggaacacc
tgggccaaggggtactacacagaaggcactgagctgatggagtcggtgatggacactgtg
aggcaggaagctgagagctgtgactgcctgcagggtttccagctggcccactccctgggt
ggggggactgggtctgggatgggtacccttctactcagtaagatccaggaggaataccca
gacaggatcataaacacattcagtgtcctgccctcgcccaaggtgccagataccatggtg
gaaccctacaatgccatcctctcaatccaccagctcatagaaaatgcacatgagaccttt
tgtattgataacaaagcactgtacaatatttgttccagaaccctacaactgcccagatcc
acctatggtgacttgaatcacatggtatctgctaccatgagtggggtcaccacgtgcctg
cgcttcccaggccagctgaatgctgacctgtggaagctggctgtgaacatggtctcattt
ccccggctgcacttcttcatgcctagctttgctccactgaccagccggggcagccggcag
taccaggccctgacggtggctgagcttatccaggagatgtttgatgctaagaatatgacg
gctgcctgtgacccccgtcgtggctgctacctaacggtgggtgccattttcagaggtcac
atgtccatgaaggaggtggatgagcagatgctcaatcttcaaaagaacagcagccacttt
gcttatcggctccctcacaatgtaaaaacagccacctgtgacatcccatccaaggggcta
gaaatatgggccactggaatcagtaataacacggccatccaggagctgttcaagcgtact
atggagcggttcacagccatgttcaggcacaaggcctttctccactggtacaccggcgag
ggcatggatgagatggaatttaccgaggccgagagcaacctgaaaaatcttatggcagag
taccaggatgccacggccaaggaggaggagtttgaggagtctgctgaggaggaggtggcc
tag

DBGET integrated database retrieval system