KEGG   Pongo abelii (Sumatran orangutan): 100172971
Entry
100172971         CDS       T01416                                 

Gene name
PAK6
Definition
(RefSeq) serine/threonine-protein kinase PAK 6
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04360  Axon guidance
pon04510  Focal adhesion
pon04660  T cell receptor signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05170  Human immunodeficiency virus 1 infection
pon05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100172971 (PAK6)
   04014 Ras signaling pathway
    100172971 (PAK6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100172971 (PAK6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100172971 (PAK6)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100172971 (PAK6)
  09158 Development and regeneration
   04360 Axon guidance
    100172971 (PAK6)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100172971 (PAK6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100172971 (PAK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100172971 (PAK6)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100172971 (PAK6)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: STE group
  STE20 family
   100172971 (PAK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 100172971
NCBI-ProteinID: NP_001126024
Ensembl: ENSPPYG00000006346
UniProt: Q5R8Z4 A0A2J8T317
LinkDB
Position
15
AA seq 681 aa
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRIT
RVQLQPMKTVVRGSTMPMDGYISGLLNDIQKLSVISSNTLRGRSPTSRRRAQSLGLLGDE
HWATDPDMYLQSPQSERTDPHGLYLSCNGGTPAGHKQMPWPEPQSPRVLPNGLAAKAQSL
GPAEFQGASQRCLQLGACLQSSPPGASPPTGTNRRGMKAAKHGSEEARPQSCLVGSATGR
PGGEGSPSPKTRESSLKRRLFRSMFLSTAATAPPSSSKPGPPPQSKPNSSFRPPQKDNPP
SLVAKAQSLPSDQPVGTFSPLTTSDTSSPQKSLRTAPATGQLPGRSSPAGSPRTWHAQIS
TSNLYLPQDPTVAKGALAGEDTGVVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGI
VCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHFNVVEMYKSYLVGEELWVL
MEFLQGGALTDIVSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRV
KLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPP
YFSDSPVQAMKRLRDSPPPKLKNSHKVSPVLRDFLERMLVRDPQERATAQELLDHPFLLQ
TGLPECLVPLIQLYRKQTSTC
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgttccgcaagaaaaagaagaaacgccctgagatctcagcgccacagaacttccagcac
cgtgtccacacctccttcgaccccaaagaaggcaagtttgtgggcctccccccacaatgg
cagaacatcctggacacactgcggcgccccaagcccgtggtggacccttcgcgaatcaca
cgggtgcagctccagcccatgaagacagtggtgcggggcagcacgatgcccatggatggc
tacatctcggggctgctcaacgacatccagaagttgtcagtcatcagctccaacaccctg
cgtggccgcagccccaccagccggcggcgggcacagtccctggggctgctgggggatgag
cactgggccaccgacccagacatgtacctccagagcccccagtctgagcgcactgacccc
catggcctctacctcagctgcaacgggggcacaccagcaggccacaagcagatgccgtgg
cccgagccacagagcccacgggtcctgcccaatgggctggctgcaaaggcacagtccctg
ggccccgccgagtttcaaggtgcctcgcagcgctgtctgcagctgggtgcctgcctgcag
agctccccaccaggagcctcgccccccacgggcaccaataggcgtggaatgaaggctgcc
aagcatggctctgaggaggcccggccacagtcctgcctggtgggctcagccacaggcagg
ccaggtggggaaggcagccctagccctaagacccgggagagcagcctgaagcgcaggcta
ttccgaagcatgttcctgtccactgctgccacggcgcctccaagcagcagcaagccaggc
cctccaccacagagcaagcccaactcctctttccgaccgccgcagaaagacaacccccca
agcctggtggccaaggcccagtccttgccctcggaccagccggtggggaccttcagccct
ctgaccacttcagataccagcagcccccagaagtccctccgcacagccccggccacaggc
cagcttccaggccggtcttccccagcgggttccccccgcacctggcacgcccagatcagc
accagcaacctgtacctgccccaggaccccacggttgccaagggcgccctggctggtgag
gacacaggtgttgtgacacatgagcaattcaaggctgcgctcaggatggtggtggaccag
ggtgacccccggctgctgctggacagctacgtgaagattggcgagggctccaccggcatc
gtctgcttggcccgagagaagcactcgggccgccaggtggccgtcaagatgatggacctc
aggaagcagcagcgcagggagctgctcttcaacgaggtggtgatcatgcgggactaccag
cacttcaacgtggtggagatgtacaagagctacctggtgggtgaggagctgtgggtgctc
atggagttcctgcagggaggagccctcacagacatcgtctcccaagtcaggctgaatgag
gagcagatcgccactgtgtgtgaggctgtgctgcaggctctggcctacctgcatgctcag
ggtgtcatccaccgggacatcaagagtgactccatcctgctgaccctcgatggcagggtg
aagctctcagacttcggattctgtgctcagatcagcaaagacgtccctaagaggaagtcc
ctggtgggaaccccctactggatggctcctgaagtgatctccaggtctttgtatgccacc
gaggtggatatctggtctctgggcatcatggtgattgagatggtggatggggagccaccg
tacttcagtgactccccagtgcaagccatgaagaggctccgggacagccccccacccaag
ctgaaaaactctcacaaggtctccccagtgctgcgagacttcctggagcggatgctggtg
cgggacccccaagagagagccacagcccaggagctcctagatcaccccttcctgctgcag
acagggctacctgagtgcctggtgcccctgatccagctctaccgaaagcagacctccacc
tgctga

KEGG   Pongo abelii (Sumatran orangutan): 100174593
Entry
100174593         CDS       T01416                                 

Gene name
PAK7
Definition
(RefSeq) serine/threonine-protein kinase PAK 7
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04360  Axon guidance
pon04510  Focal adhesion
pon04660  T cell receptor signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05170  Human immunodeficiency virus 1 infection
pon05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100174593 (PAK7)
   04014 Ras signaling pathway
    100174593 (PAK7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100174593 (PAK7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100174593 (PAK7)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100174593 (PAK7)
  09158 Development and regeneration
   04360 Axon guidance
    100174593 (PAK7)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100174593 (PAK7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100174593 (PAK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100174593 (PAK7)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100174593 (PAK7)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: STE group
  STE20 family
   100174593 (PAK7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 100174593
NCBI-ProteinID: NP_001127517
UniProt: Q5R7U3
LinkDB
Position
20
AA seq 719 aa
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHA
EENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHIMKMKHGEA
YYSEMKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTA
GTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQRSPQPTMRQRSRSGSGLQEPMMPFG
ASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS
QSKSGYSSSSHQYPSGYHKATLYHHPSLQSSSQYISTASYLSSLSLSSSTYPPPSWGSSS
DQQPSRVSHEQFRAALQLVVSPGDPREYLDNFIKIGEGSTGIVCIATEKHTGKQVAVKKM
DLRKQQRRELLFNEVVIMRDYHHDNVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTRM
NEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIELSDFGFCAQVSKEVPKR
KSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLP
PRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgtttggcaagaaaaagaaaaagattgaaatatctggcccatccaactttgaacacagg
gttcatactgggtttgatccacaagagcagaagtttaccggccttccccagcagtggcac
agcctgttagcagatacggccaacaggccaaagcctatggtggacccttcatgcatcaca
cccatccagctggctcctatgaagacaatcgttagaggaaacaaaccctgcaaggaaacc
tccatcaacggcctgctagaggattttgacaacatctcggtgactcgctccaactcccta
aggaaagaaagcccacccaccccagatcagggagcctccagccacggtccaggccacgcg
gaagaaaatggcttcatcaccttctcccagtattctagcgaatccgatactactgctgac
tacacgaccgaaaagtacagggagaagagtctctatggagacgatctggatccgtattat
agaggcagccacgcagccaagcaaaatggtcacataatgaaaatgaagcacggggaggcc
tactattctgagatgaagcctttgaaatccgattttgccagattttctgccgattatcac
tcacatttggactcactgagcaaaccaagtgaatatagtgacctcaagtgggagtatcag
agagcctcgagtagctcccctctggattattcattccaattcacaccttctagaactgca
gggaccagcgggtgctccaaggagagcctggcgtacagtgaaagtgaatggggacccagc
ctggatgactatgacaggaggccaaagtcttcgtacctgaatcagaggagccctcagccc
accatgcggcagaggtccaggtcaggctcgggactccaggaaccgatgatgccatttgga
gcaagtgcatttaaaacccatccccaaggacactcctacaactcctacacctaccctcgc
ttgtccgagcccacaatgtgcattccaaaggtggattatgatcgagcacagatggtcctc
agccctccactgtcagggtctgacacctaccccaggggccctgccaaactacctcaaagt
caaagcaaatcgggctattcctcaagcagtcaccagtacccgtctgggtaccacaaagcc
accttgtaccatcacccctccctgcagagcagttcgcagtacatctccacggcttcctac
ctgagctccctcagcctctcatccagcacctacccgccgcccagctggggctcctcctcc
gaccagcagccctccagggtgtcccatgaacagtttcgggcagccctgcagctggtggtc
agcccaggagaccccagggaatacttggacaactttatcaaaatcggggaaggctcaacc
ggcatcgtatgcatcgccaccgagaaacacacagggaaacaagttgcagtgaagaaaatg
gacctccggaagcaacagagacgagaactgcttttcaatgaggtggtgatcatgcgggat
taccaccatgacaatgtagttgacatgtacaacagctaccttgtcggcgatgagctctgg
gtggtcatggagtttctagaaggtggtgccttgacagacattgtgactcacaccagaatg
aatgaagaacagatagctactgtctgcctgtcagttctgagagctctctcctaccttcat
aaccaaggagtgattcacagggacataaaaagtgactccatcctcctgacaagcgatggc
cggatagagttgtctgattttggtttctgtgctcaagtttccaaagaggtgccgaagagg
aaatcattggttggcactccctactggatggcccctgaggtgatttctaggctaccttat
gggacagaggtggacatctggtccctcgggatcatggtgatagaaatgatcgatggcgag
cccccctacttcaacgagcctcccctccaggcgatgcggaggatccgggacagtttacct
ccaagagtgaaggacctacacaaggtttcttcagtgctccggggattcctagacctgatg
ttggtgagggagccctctcagagagcaacagcccaggaactcctcggacatccattctta
aaactagcaggtccaccgtcttgcatcgttcccctcatgagacaatacaggcatcactga

KEGG   Pongo abelii (Sumatran orangutan): 100294571
Entry
100294571         CDS       T01416                                 

Gene name
PAK3
Definition
(RefSeq) serine/threonine-protein kinase PAK 3
  KO
K05733  p21-activated kinase 3 [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04360  Axon guidance
pon04510  Focal adhesion
pon04660  T cell receptor signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05132  Salmonella infection
pon05170  Human immunodeficiency virus 1 infection
pon05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100294571 (PAK3)
   04014 Ras signaling pathway
    100294571 (PAK3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100294571 (PAK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100294571 (PAK3)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100294571 (PAK3)
  09158 Development and regeneration
   04360 Axon guidance
    100294571 (PAK3)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100294571 (PAK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100294571 (PAK3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100294571 (PAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100294571 (PAK3)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100294571 (PAK3)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: STE group
  STE20 family
   100294571 (PAK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Spt5_N DSHCT APH Ribosomal_60s
Other DBs
NCBI-GeneID: 100294571
NCBI-ProteinID: NP_001153267
Ensembl: ENSPPYG00000020634
UniProt: Q5RDR1
LinkDB
Position
X
AA seq 544 aa
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTN
KKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVL
DVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEE
EEDENEPPPVIAPRPEHTKSIYTRSVVESIASPAVPNKEVTPPSAENANSSTLYRNTDRQ
RKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMN
LQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMD
EGQIAAVCRECLQALDFLRSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRS
TMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTP
ELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIK
NSSR
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgtctgacggtctggataatgaagagaaaccccccgctcctccactgaggatgaatagt
aacaaccgggattcttcagcactcaaccacagctccaaaccacttcccatggcccctgaa
gagaagaataagaaagccaggcttcgctctatcttcccaggaggaggggataaaaccaat
aagaagaaggagaaagagcgcccagagatctctcttccttcagactttgagcatacgatt
catgtggggtttgatgcagtcaccggggaattcactggaattcccgagcaatgggcacga
ttactccaaacctccaacataacaaaattggaacagaagaagaacccacaagctgttcta
gatgttctcaaattctatgattccaaagaaacagtcaacaaccagaaatacatgagcttt
acatcaggagataaaagtgcacatggatacatagcagcccatccttcgagtacaaaaaca
gcatctgagcctccattggcccctcctgtgtctgaagaagaagatgaagaggaagaagaa
gaagaagatgaaaatgagccaccaccagttatcgcaccaagaccagagcatacaaaatca
atctacactcgttctgtagttgaatccattgcttcaccagcagtaccaaataaagaggtc
acaccaccctctgctgaaaatgccaattccagtactttgtacaggaacacagatcggcaa
agaaaaaaatccaagatgacagatgaggagatcttagagaagctaagaagcattgtgagt
gttggggacccaaagaaaaaatacacaagatttgaaaaaattggtcaaggggcatcaggc
actgtttatacagcactagacattgcaacaggacaagaggtggccataaagcagatgaac
cttcaacagcaacccaagaaggaattaattattaatgaaattctggtcatgagggaaaat
aagaaccctaatattgttaattatttagatagctacttggtgggtgatgaactatgggta
gtcatggaatacttggctggtggctctctgactgatgtggtcacggagacctgtatggat
gaaggacagatagcagctgtctgcagagagtgcctgcaagctttggatttcttgcgctca
aaccaggtgatccatagagatataaagagtgacaatattcttctcgggatggatggctct
gttaaattgactgactttgggttctgtgcccagatcactcctgagcaaagtaaacgaagc
actatggtgggaaccccatattggatggcacctgaggtggtgactcgaaaagcttatggt
ccgaaagttgatatctggtctctgggaattatggcaattgaaatggtggaaggtgaaccc
ccttaccttaatgaaaatccactcagggcattgtatctgatagccactaatggaacccca
gagctccagaatcctgagagactgtcggctgtattccgtgactttttaaatcgctgtctt
gagatggatgtggataggcgaggatctgccaaggagcttttgcagcatccatttttaaaa
ttagccaagcctctctccagcctgactcctctgattatcgctgcaaaggaagcgattaag
aacagcagccgctaa

KEGG   Pongo abelii (Sumatran orangutan): 100439815
Entry
100439815         CDS       T01416                                 

Gene name
PAK2
Definition
(RefSeq) serine/threonine-protein kinase PAK 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04360  Axon guidance
pon04510  Focal adhesion
pon04660  T cell receptor signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05170  Human immunodeficiency virus 1 infection
pon05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100439815 (PAK2)
   04012 ErbB signaling pathway
    100439815 (PAK2)
   04014 Ras signaling pathway
    100439815 (PAK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100439815 (PAK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100439815 (PAK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100439815 (PAK2)
  09158 Development and regeneration
   04360 Axon guidance
    100439815 (PAK2)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100439815 (PAK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100439815 (PAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100439815 (PAK2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100439815 (PAK2)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: STE group
  STE20 family
   100439815 (PAK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH Kdo zinc-ribbons_6
Other DBs
NCBI-GeneID: 100439815
NCBI-ProteinID: XP_024096969
LinkDB
Position
3
AA seq 524 aa
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAP
PVIAPRPDHTKSIYTRSVIDPVPAPVGDSNVDGGAKSLDKQKKKTKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagacaagcctccagcacctcctgtgcgaatgagcagc
accatctttagcactggaggcaaagaccctttgtcagccaatcacagtttgaaacctttg
ccttctgttccagaagagaaaaagcccaggcataaaatcatctctatattctcaggcaca
gagaaaggaagtaaaaagaaagaaaaggaacggccagaaatttctcctccatctgatttt
gagcacaccatccatgttggctttgatgctgttactggagaattcactggtatgccagaa
cagtgggctcgattactacagacctccaatatcaccaaactagagcaaaagaagaatcct
caggctgtgctggatgtcctaaagttctacgactccaacacagtgaagcagaaatatctg
agctttactcctcctgagaaagatggctttccttctggaacaccagcactgaatgccaag
ggaacagaagcacctgcagtagtgacagaggaggaggatgatgatgaagagactgctcct
cccgttattgccccgcgaccggatcacacgaaatcaatttacacacggtctgtaattgac
cctgttcctgcaccagttggtgattcaaatgttgatggtggtgccaagtctttagacaaa
cagaaaaagaagactaagatgacagatgaagagattatggagaaattaagaactattgtg
agcataggtgaccctaagaaaaaatatacaagatatgaaaaaattgggcaaggggcttct
ggtacagttttcactgctactgacgttgcattgggacaggaggttgctatcaaacaaatt
aatttacagaaacagccaaagaaggaattgatcattaatgagattctggtgatgaaagaa
ttaaaaaatcccaacatcgttaacttcttggacagttacctggtaggagatgaattgttt
gtggtcatggaataccttgctggggggtcactcactgatgtggtaacagaaacctgcatg
gatgaagcacagattgctgctgtgtgcagagagtgtttacaggcgttggagtttttacat
gctaatcaagtgatccacagagacatcaaaagtgacaatgtacttttgggaatggaagga
tcagttaagctcactgactttggtttctgtgcccagatcacccctgagcagagcaaacgc
agtaccatggtcggaacgccatactggatggcaccagaggtggttacacggaaagcttat
ggccctaaagtcgacatatggtctctgggtatcatggctattgagatggtagaaggagag
cctccatacctcaatgaaaatcccttgagggccttgtacctaatagcaactaatggaacc
ccagaacttcagaatccagagaaactttccccaatatttcgagatttcttaaatcgatgt
ttggaaatggatgtggaaaaaaggggttcagccaaagaattattacagcatcctttcctg
aaactggccaaaccgttatctagcttgacaccactgatcatggcagctaaagaagcaatg
aagagtaaccgttaa

KEGG   Pongo abelii (Sumatran orangutan): 100449316
Entry
100449316         CDS       T01416                                 

Gene name
PAK1
Definition
(RefSeq) serine/threonine-protein kinase PAK 1 isoform X1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04360  Axon guidance
pon04392  Hippo signaling pathway - multiple species
pon04510  Focal adhesion
pon04625  C-type lectin receptor signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04660  T cell receptor signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05132  Salmonella infection
pon05170  Human immunodeficiency virus 1 infection
pon05205  Proteoglycans in cancer
pon05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100449316 (PAK1)
   04012 ErbB signaling pathway
    100449316 (PAK1)
   04014 Ras signaling pathway
    100449316 (PAK1)
   04392 Hippo signaling pathway - multiple species
    100449316 (PAK1)
   04024 cAMP signaling pathway
    100449316 (PAK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100449316 (PAK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100449316 (PAK1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100449316 (PAK1)
   04650 Natural killer cell mediated cytotoxicity
    100449316 (PAK1)
   04660 T cell receptor signaling pathway
    100449316 (PAK1)
   04666 Fc gamma R-mediated phagocytosis
    100449316 (PAK1)
   04062 Chemokine signaling pathway
    100449316 (PAK1)
  09158 Development and regeneration
   04360 Axon guidance
    100449316 (PAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100449316 (PAK1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100449316 (PAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100449316 (PAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100449316 (PAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100449316 (PAK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100449316 (PAK1)
   03036 Chromosome and associated proteins [BR:pon03036]
    100449316 (PAK1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100449316 (PAK1)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: STE group
  STE20 family
   100449316 (PAK1)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100449316 (PAK1)
 Endocytosis
  Macropinocytosis
   Kinases
    100449316 (PAK1)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100449316 (PAK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH DSHCT Kdo
Other DBs
NCBI-GeneID: 100449316
NCBI-ProteinID: XP_009245133
Ensembl: ENSPPYG00000003708
UniProt: H2NER3
LinkDB
Position
11
AA seq 545 aa
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTE
KQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ
MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC
MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNG
TPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEA
TKNNH
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgtcaaataacggcctagacattcaagacaaacccccagcccctccgatgagaaatacc
agcactatgattggagccggcagcaaagatgctggaaccctaaaccatggttctaaacct
ctgcctccaaacccagaggagaagaaaaagaaggaccgattttaccgatccatcttacct
ggagataaaacaaataaaaagaaagagaaagagcggccagagatttctctcccttcagat
tttgaacacacaattcatgtcggttttgatgctgtcacaggggagtttacgggaatgcca
gagcagtgggcccgcttgcttcagacatcaaatatcactaagtcggagcagaagaaaaac
ccacaggctgttctggatgtgttggagttttacaactcaaagaagacatccaacagccag
aaatacatgagctttacagataagtcagctgaggactacaattcttctaatgccttgaat
gtgaaggctgtgtctgagactcctgcagtgccaccagtttcagaagatgaggatgatgat
gatgatgatgctaccccaccaccagtgattgctccacgcccagagcacacaaaatctgta
tacacacggtctgtgattgaaccacttcctgtcactccaactcgggacgtggctacatct
cccatttcacctactgaaaataacaccactccaccagatgctttgacccggaatactgag
aagcagaagaagaagcctaaaatgtctgatgaggagatcttggagaaattacgaagcata
gtgagtgtgggcgatcctaagaagaaatatacacggtttgagaagattggacaaggtgct
tcaggcaccgtgtacactgcaatggatgtggccacaggacaggaggtggccattaagcag
atgaatcttcagcagcagcccaagaaagagctgattattaatgagatcctggtcatgagg
gaaaacaagaacccaaacattgtgaattacttggacagttacctcgtgggagatgagctg
tgggttgttatggaatacttggctggaggctccttgacagacgtggtgacagaaacctgc
atggatgaaggccagattgcagctgtgtgccgtgagtgtctgcaggctctggagtttttg
cattcgaaccaggtcattcacagagacatcaagagtgacaatattctgttgggaatggat
ggctctgtcaagctaactgactttggattctgtgcacagataaccccagagcagagcaaa
cggagcaccatggtaggaaccccatactggatggcaccagaggttgtgacacgaaaggcc
tatgggcccaaggttgacatctggtccctgggcatcatggccatcgaaatgattgaaggg
gagcctccatacctcaatgaaaaccctctgagagccttgtacctcattgccaccaatggg
accccagaacttcagaacccagagaagctgtcagctatcttccgggactttctgaaccgc
tgtctcgagatggatgtggagaagagaggttcagctaaagagctgctacagcatcaattc
ctgaagattgccaagcccctctccagcctcactccactgattgctgcagcaaaggaggca
acaaagaacaatcactaa

KEGG   Pongo abelii (Sumatran orangutan): 100457556
Entry
100457556         CDS       T01416                                 

Gene name
PAK4
Definition
(RefSeq) serine/threonine-protein kinase PAK 4 isoform X1
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04360  Axon guidance
pon04510  Focal adhesion
pon04660  T cell receptor signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05170  Human immunodeficiency virus 1 infection
pon05206  MicroRNAs in cancer
pon05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100457556 (PAK4)
   04014 Ras signaling pathway
    100457556 (PAK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100457556 (PAK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100457556 (PAK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100457556 (PAK4)
  09158 Development and regeneration
   04360 Axon guidance
    100457556 (PAK4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100457556 (PAK4)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100457556 (PAK4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100457556 (PAK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100457556 (PAK4)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100457556 (PAK4)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: STE group
  STE20 family
   100457556 (PAK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo KIND hnRNP_Q_AcD
Other DBs
NCBI-GeneID: 100457556
NCBI-ProteinID: XP_009230850
LinkDB
Position
19
AA seq 598 aa
MFGKRKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLVDPACIT
SIQPGAPKTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEE
LATTARGGPGKAGSRGRFAGHSEAGGGSGDRRRAGPEKRPKSSREGSGGPQESSRDKRPL
SGPDVGTPQPAGLASGAKLAAGRPFNTYPRADTDHPSRGAQGEPHDVAPNGPSAGGLAVP
QSSSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPARTPATPAAPVAPAVPGPPGPCSPQ
REPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMD
LRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMN
EEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRK
SLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPP
RLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgtttgggaaaaggaagaagcgggtggagatctccgcgccatccaacttcgagcaccgc
gtgcacacgggcttcgatcagcacgagcagaagttcacggggctgccccgccagtggcag
agcctgatcgaggagtcggctcgccggcccaagcccctcgtcgaccccgcctgcatcacc
tccatccagcccggggcccccaagaccatcgtgcggggcagcaaaggtgccaaggatggg
gccctcacgctgctactggacgagtttgagaacatgtcggtgacacgctccaactccctg
cggagagacagcccgccgccgcccgcccgtgcccggcaggaaaatgggatgccagaggag
ctggccaccacggccagagggggcccggggaaggcaggcagccgaggccggttcgccggt
cacagcgaggcgggtggcggcagtggtgacaggcgacgggcggggccagagaagaggccc
aagtcttccagggagggctcaggggggccccaggagtcctcccgggacaaacgccccctc
tccgggcctgacgtcggcaccccccagcctgctggtctggccagtggggcgaaactggca
gctggccggccctttaacacctacccgagggctgacacggaccacccatcccggggtgcc
cagggggagcctcatgacgtggcccctaacgggccatcagcagggggcctggccgtcccc
cagtcctcctcctcctcctcctcccggcctcccacccgagcccgaggtgcccccagccct
ggagtactgggcccccacgcctcggagccccagctggcccctccagcccgcacccctgcc
acccctgccgcccctgtcgcccctgctgttcctgggccccctggcccctgctcaccacag
cgggagccacagcgagtatcccatgagcagttccgggctgccctgcagctggtggtggac
ccaggcgacccccgttcctacctggacaacttcatcaagatcggcgagggctccacgggc
atcgtgtgcatcgccaccgtgcgcagctcgggcaagctggtggccgtcaagaagatggac
ctgcgcaagcagcagaggcgcgagttgctcttcaacgaggtggtgatcatgagggactac
cagcacgagaatgtggtggagatgtacaacagctacctggtgggggacgagctctgggtg
gtcatggagttcctggaaggaggcgccctcaccgacatcgtcacccacaccaggatgaac
gaggagcagatcgcggccgtgtgcctggcagtgctgcaggccctgtcggtgctccacgcc
cagggcgtcatccaccgggacatcaagagtgactcaatcctgctgacccatgacggcagg
gtgaagctgtcagacttcgggttctgtgcccaggtgagcaaggaagtgccccgaaggaag
tcgctggtcggcacgccctactggatggccccagagctcatctcccgccttccctacggg
ccagaggtggacatctggtcgctggggataatggtgattgagatggtagacggagagccc
ccctacttcaacgagccacccctcaaagccatgaagatgattcgggacaacctgccaccc
cgactgaagaacctgcacaaggtgtcgccatccctgaagggcttcctggaccgcctgctg
gtgcgggaccctgcccagcgggccacggcagccgagctgctgaagcacccattcctggcc
aaggcagggccgcccgccagcatcgtgcccctcatgcgccagaaccgcaccagatga

DBGET integrated database retrieval system