KEGG   Pongo abelii (Sumatran orangutan): 100173014
Entry
100173014         CDS       T01416                                 

Gene name
PDCD4
Definition
(RefSeq) programmed cell death protein 4
  KO
K16865  programmed cell death protein 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100173014 (PDCD4)
   05205 Proteoglycans in cancer
    100173014 (PDCD4)
SSDB
Motif
Pfam: MA3 Adhes-Ig_like
Other DBs
NCBI-GeneID: 100173014
NCBI-ProteinID: NP_001126062
Ensembl: ENSPPYG00000002649
UniProt: Q5R8S3
LinkDB
Position
10
AA seq 469 aa
MDVENEQILNVNPADPDNLSDSLFSGDEESAGTEEIKNEINGNWISASSINEARINAKAK
RRLRKNSSRDSGRGDSVSDNGSDTLRSGVTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGG
KGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGD
TNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTSDVEKSF
DKSLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATV
LLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFH
HELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVP
HSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggatgtagaaaatgagcagatactgaatgtaaaccctgcagatcctgataatttaagt
gactctctcttttccggtgatgaagaaagtgctgggactgaggaaataaagaatgaaata
aatggaaattggatttcagcatcctccattaatgaggctagaattaatgccaaggcaaaa
aggcgactaaggaaaaactcatcccgggactctggcagaggcgattcggtcagcgacaat
gggagtgacacccttagaagtggagtaactgtgccaaccagtccaaagggaagattgctg
gataggcgatccagatctgggaaaggaaggggactaccaaagaaaggtggtgcaggaggc
aaaggtgtctggggtacacctggacaggtgtatgatgtggaggaggtggatgtgaaagat
cctaactatgatgatgaccaggagaactgtgtttatgaaactgtagttttgcctttggat
gaaagggcatttgagaagactttaacaccaatcatacaggaatattttgagcatggagat
actaatgaagttgcggaaatgttaagagatttaaatcttggtgaaatgaaaagtggagta
ccagtgttggcagtatccttagcattggaggggaaggctagtcatagagagatgacatct
aagcttctttctgacctctgtgggacagtaatgagcacaagtgatgtggaaaaatcattt
gataaatcgttgaaagatctacctgaattagcattggatactcctagagcaccacagttg
gtgggccagtttattgctagagctgttggagatggaattttatgtaatacctatattgat
agttacaaaggaactgtagattgtgtgcaggctagagctgctctggataaggctaccgtg
cttctgagtatgtctaaaggtggaaagcgtaaagatagtgtgtggggctctggaggtggt
cagcagtctgtcaatcaccttgttaaagagattgatatgctgctgaaagaatatttactc
tctggagacatatctgaagctgaacattgccttaaggaactggaagtacctcattttcac
catgagcttgtatatgaagctattataatggttttggagtcaactggagaaagtacattt
aagatgattttggatttattaaagtccctttggaagtcttctaccattactgtagaccaa
atgaaaagaggttatgagagaatttacaatgaaattccggacattaatctggatgtccca
cattcatactctgtgctggagcggtttgtagaagaatgttttcaggctggaataatttcc
aaacaactcagagatctttgtccttcaaggggcagaaagcgttttgtaagcgaaggagat
ggaggtcgtcttaaaccagagagctactga

DBGET integrated database retrieval system