KEGG   Pongo abelii (Sumatran orangutan): 100173045
Entry
100173045         CDS       T01416                                 

Gene name
CXCL12
Definition
(RefSeq) stromal cell-derived factor 1 precursor
  KO
K10031  C-X-C motif chemokine 12
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04062  Chemokine signaling pathway
pon04064  NF-kappa B signaling pathway
pon04360  Axon guidance
pon04670  Leukocyte transendothelial migration
pon04672  Intestinal immune network for IgA production
pon04810  Regulation of actin cytoskeleton
pon05163  Human cytomegalovirus infection
pon05200  Pathways in cancer
pon05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100173045 (CXCL12)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100173045 (CXCL12)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100173045 (CXCL12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100173045 (CXCL12)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100173045 (CXCL12)
   04672 Intestinal immune network for IgA production
    100173045 (CXCL12)
   04062 Chemokine signaling pathway
    100173045 (CXCL12)
  09158 Development and regeneration
   04360 Axon guidance
    100173045 (CXCL12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100173045 (CXCL12)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100173045 (CXCL12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100173045 (CXCL12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100173045 (CXCL12)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100173045 (CXCL12)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Chemokines
   100173045 (CXCL12)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Chemokines
   100173045 (CXCL12)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100173045
NCBI-ProteinID: NP_001126092
Ensembl: ENSPPYG00000002220
UniProt: Q5R8M6
LinkDB
Position
10
AA seq 93 aa
MNAKVVDVLALVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNDNRQVCIDPKLKWIQEYLEKALNKRFKM
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaacgccaaggtcgtggacgtgctggctctcgtgctgaccgcgctctgcctcagcgac
gggaagcccgtcagcctgagctacagatgcccatgccgattcttcgaaagccatgttgcc
agagccaacgtcaagcatctcaaaattcttaacactccaaactgtgcccttcagattgta
gcccggctgaagaacgacaacagacaagtgtgcattgacccgaagctaaagtggattcag
gagtacctggagaaagctttaaacaagaggttcaagatgtga

DBGET integrated database retrieval system