KEGG   Pongo abelii (Sumatran orangutan): 100173068
Entry
100173068         CDS       T01416                                 

Gene name
PLAT
Definition
(RefSeq) tissue-type plasminogen activator precursor
  KO
K01343  tissue plasminogen activator [EC:3.4.21.68]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04371  Apelin signaling pathway
pon04610  Complement and coagulation cascades
pon05202  Transcriptional misregulation in cancer
pon05215  Prostate cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100173068 (PLAT)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100173068 (PLAT)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100173068 (PLAT)
  09162 Cancer: specific types
   05215 Prostate cancer
    100173068 (PLAT)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100173068 (PLAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pon01002]
    100173068 (PLAT)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100173068 (PLAT)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.68  t-plasminogen activator
     100173068 (PLAT)
Peptidases and inhibitors [BR:pon01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100173068 (PLAT)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   100173068 (PLAT)
SSDB
Motif
Pfam: Trypsin Kringle fn1 EGF Trypsin_2 DUF1986 hEGF
Other DBs
NCBI-GeneID: 100173068
NCBI-ProteinID: NP_001126112
Ensembl: ENSPPYG00000018549
UniProt: Q5R8J0
LinkDB
Position
8
AA seq 562 aa
MNAMKRGLCCVLLLCGAVFALPSQEIHARVRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVRSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCE
IDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCR
NPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGLAYRGTHSLTESGASCLLWN
SMILIGKVYTAQNPNAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCG
LRQYSQPQFRIKGGLFADIASHPWQAAIFARHRRSPGERFLCGGILISSCWILSAAHCFQ
ERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA
QESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQH
LLNRTVADNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGEK
DVPGVYTKVTNYLDWIHDNMRP
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgaatgcaatgaagagagggctctgctgtgtgctgctgctctgtggagcagtcttcgct
ttacccagccaggaaatccatgcccgagtcagaagaggagccagatcttaccaagtgatc
tgcagagatgaaaaaacgcagatgatataccagcaacatcagtcatggctgcgccccgtg
ctcagaagcaaccgggtggaatattgctggtgcaacagcggcagggcacagtgccactcg
gtgcctgtcagaagttgcagcgagccaaggtgtttcaacgggggcacctgccagcaggcc
ctgtacttctccgatttcgtgtgccagtgccccgaaggatttgctgggaagtgctgtgaa
atagatactagggccacgtgctacgaggaccagggcatcagctacaggggcacgtggagc
acagcggagagcggcgccgagtgcaccaactggaacagcagcgcgctggcccagaagccc
tacagcgggcggaggccagacgccatcaggctgggcctggggaaccacaactactgcaga
aacccagatcgagactcaaagccctggtgctacgtcttcaaggcggggaagtacagctca
gagttctgcagcacccctgcctgctccgagggaaacagtgactgctactttgggaatggg
ttagcctaccgtggcacgcacagcctcaccgagtcgggtgcctcctgcctcctgtggaat
tccatgatcctgataggcaaagtttacacagcacagaaccccaacgcccaggcactgggc
ctgggcaaacataattactgccggaatcctgatggggacgccaagccctggtgccatgtg
ctgaagaatcgcaggctgacgtgggagtactgtgatgtgccctcctgctccacctgcggc
ctgagacagtacagccagcctcagtttcgcatcaaaggagggctcttcgccgacatcgcc
tcccacccctggcaggctgccatctttgccaggcacaggaggtcgcccggagagcggttc
ctgtgtgggggcatactcatcagctcctgctggattctctccgccgcccactgcttccag
gagaggtttccgccccaccacctgacggtgatcttgggcagaacataccgggtggtcccc
ggcgaggaggagcagaaatttgaagtagaaaaatacattgtccataaggaattcgatgat
gacacttacgacaatgacattgcgctgctgcagctgaaatcggattcgtcccgctgtgcc
caggagagcagcgtggtccgcactgtgtgccttcccccggcggacctgcagctgccggac
tggacggagtgtgagctctccggctacggcaagcatgaggccttgtctcctttctattcg
gagcggctgaaggaggctcatgtcagactgtacccatccagccgctgcacatcacaacat
ttacttaacagaacggtcgccgacaacatgctgtgtgctggagacactcggagcggcggg
ccccaggcaaacttgcacgacgcctgccagggcgattcgggaggccccctggtgtgtctg
aacgatggccgcatgactttggtgggcatcatcagctggggcctgggctgtggagagaag
gatgtcccgggtgtgtacaccaaggttaccaactacctagactggattcatgacaacatg
cgaccgtaa

DBGET integrated database retrieval system