KEGG   Pongo abelii (Sumatran orangutan): 100173168
Entry
100173168         CDS       T01416                                 

Gene name
VCAM1
Definition
(RefSeq) vascular cell adhesion protein 1 precursor
  KO
K06527  vascular cell adhesion molecule 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04064  NF-kappa B signaling pathway
pon04514  Cell adhesion molecules
pon04668  TNF signaling pathway
pon04670  Leukocyte transendothelial migration
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05143  African trypanosomiasis
pon05144  Malaria
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100173168 (VCAM1)
   04668 TNF signaling pathway
    100173168 (VCAM1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100173168 (VCAM1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100173168 (VCAM1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100173168 (VCAM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100173168 (VCAM1)
  09174 Infectious disease: parasitic
   05144 Malaria
    100173168 (VCAM1)
   05143 African trypanosomiasis
    100173168 (VCAM1)
CD molecules [BR:pon04090]
 Proteins
  100173168 (VCAM1)
Lectins [BR:pon04091]
 I-type lectins (Siglecs)
  100173168 (VCAM1)
SSDB
Motif
Pfam: I-set Ig_3 C2-set ig Ig_2 V-set C2-set_2 ICAM_N Ig_5 Ig_4 Ig_6 Adhes-Ig_like INCA1
Other DBs
NCBI-GeneID: 100173168
NCBI-ProteinID: NP_001126200
Ensembl: ENSPPYG00000001112
UniProt: Q5R847
LinkDB
Position
1
AA seq 739 aa
MPGKMIVIFGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWR
TQIDSPLNGKVTNEGTASTLTMNPVSFGNEHSYLCTATCKSRKLEKGIQVEIYSFPKDPE
IHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEV
TFTPVIEDIGKVLVCRAKLRIDEMDSVPTERQAVKELQVYISPKNTVISVNPSTKLQEGS
SVTMTCSSEGLPPPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLVGKN
RKEVELIVQEKPFIVEISPGPRIAARIGDSVMLTCSVIGCESPSFSWRTQVDSPLSGKVR
SEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGDLVNGSS
VTVSCKVPSVYPLDRLKIELLKGETILKNIEFLEDTDMKSLENKSLEMTFIPTIEDTGKA
LVCQAKLHIDDMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFP
APKILWSRQLPNGELQPLSENATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTP
KDIKLTAFPSESVKEGDTVIISYTCGNVPETWIILKKKAETGDTVLKSIDGAYTIRKAQL
KDAGVYECESKNKVGSQLRSLTFDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYFA
RKANMKGSYSLVEAQKSKV
NT seq 2220 nt   +upstreamnt  +downstreamnt
atgcctgggaagatgatcgtgatctttggagcctcaaatatactttggataatgtttgca
gcttctcaagcttttaaaatcgagaccaccccagaatctaggtatcttgctcagattggt
gactccgtctcattgacttgcagcaccacaggctgtgagtccccatttttctcttggaga
acccagatagatagtccactgaatgggaaggtgacgaatgaggggaccgcgtctacgctg
acaatgaatcctgttagttttgggaacgaacactcttacctgtgcacagcaacttgtaaa
tctaggaaattggaaaaaggaatccaggtggagatctactcttttcctaaggatccagag
attcatttgagtggccctctggaggctgggaagccgatcacagtcaagtgttcggttgct
gatgtatacccatttgacaggctggagatagacttactgaaaggagatcatctcatgaag
agtcaggaatttctggaggatgcagacaggaagtccctggaaaccaagagtttggaagta
acctttactcctgtcattgaggatattggaaaagttcttgtttgccgagctaaattacgt
attgatgaaatggattctgtgcccacagaaaggcaggctgtaaaagaattgcaagtctac
atatcacccaagaatacagttatttctgtgaatccatccacaaagttgcaagaaggtagc
tctgtgaccatgacttgttccagtgagggtctaccacctccagagattttctggagtaag
aaattagataatgggaatctacagcacctttctgggaatgcaactctcaccttaattgct
atgaggatggaagattctggaatttatgtgtgtgaaggagttaatttggttgggaaaaac
agaaaagaggtggaattaattgttcaagagaaaccatttattgttgagatctcccctgga
ccccggattgctgctcggattggggactcagtcatgttgacatgtagtgtcataggctgt
gagtccccatcattctcctggagaacccaggtagacagccctctgagcgggaaggtgagg
agtgaggggaccaattccacgctgaccctgagccctgtgagttttgagaacgaacactct
tatctgtgcacagtgacttgtggacataagaaactggaaaagggaatccaggtggagctc
tactcattccctagagatccagaaatcgagatgagtggtgacctcgtgaatgggagctct
gtcactgtaagctgcaaggttcctagtgtgtacccccttgaccggttgaagattgaatta
cttaagggggagactattctgaagaatatagagtttttggaggatacggatatgaaatct
ctagagaacaaaagtttggaaatgaccttcatccctactattgaagatactggaaaagct
cttgtttgtcaggctaagttacatattgatgacatggaattcgaacccaaacaaaggcag
agtacacaaacactttatgtcaatgttgcccccagagatacaaccgtcttggtcagccct
tcctccatcctggaggaaggcagttctgtgaatatgacatgcttgagccaaggctttcct
gctccgaaaatcctgtggagcaggcagctccctaacggggagctacaacctctttctgag
aacgcaactctcaccttaatttctacaaaaatggaagattctggggtttatttatgtgaa
ggaattaaccaggctggaagaagcagaaaggaagtagaattaattatccaagttactcca
aaagacataaaacttacagcttttccttctgagagtgtcaaagaaggagacactgtcatc
atctcttatacatgtggaaatgttccagaaacatggataatcctgaagaaaaaagcagag
acaggagacacagtactaaaatctatagatggcgcctataccatccgaaaggcccagttg
aaggatgcgggagtatatgaatgtgaatctaaaaacaaagttggctcacaattaagaagt
ttaacatttgatgttcaaggaagagaaaacaacaaagactatttttctcctgagcttctc
gtgctctattttgcatcctccttaataatacctgccattggaatgataatttactttgca
agaaaagccaacatgaagggttcatatagtcttgtagaagcacagaaatcaaaagtgtag

DBGET integrated database retrieval system