KEGG   Pongo abelii (Sumatran orangutan): 100173221
Entry
100173221         CDS       T01416                                 

Gene name
HSP90AA1
Definition
(RefSeq) heat shock protein HSP 90-alpha
  KO
K04079  molecular chaperone HtpG
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04141  Protein processing in endoplasmic reticulum
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04612  Antigen processing and presentation
pon04621  NOD-like receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04659  Th17 cell differentiation
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon05132  Salmonella infection
pon05200  Pathways in cancer
pon05215  Prostate cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100173221 (HSP90AA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100173221 (HSP90AA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100173221 (HSP90AA1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100173221 (HSP90AA1)
   04612 Antigen processing and presentation
    100173221 (HSP90AA1)
   04659 Th17 cell differentiation
    100173221 (HSP90AA1)
   04657 IL-17 signaling pathway
    100173221 (HSP90AA1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100173221 (HSP90AA1)
   04914 Progesterone-mediated oocyte maturation
    100173221 (HSP90AA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100173221 (HSP90AA1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100173221 (HSP90AA1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100173221 (HSP90AA1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100173221 (HSP90AA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100173221 (HSP90AA1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pon03110]
    100173221 (HSP90AA1)
   04131 Membrane trafficking [BR:pon04131]
    100173221 (HSP90AA1)
   03051 Proteasome [BR:pon03051]
    100173221 (HSP90AA1)
   03029 Mitochondrial biogenesis [BR:pon03029]
    100173221 (HSP90AA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100173221 (HSP90AA1)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100173221 (HSP90AA1)
Chaperones and folding catalysts [BR:pon03110]
 Heat shock proteins
  HSP90
   100173221 (HSP90AA1)
Membrane trafficking [BR:pon04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100173221 (HSP90AA1)
Proteasome [BR:pon03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100173221 (HSP90AA1)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    100173221 (HSP90AA1)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100173221 (HSP90AA1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 Zip LOH1CR12
Other DBs
NCBI-GeneID: 100173221
NCBI-ProteinID: XP_024087565
Ensembl: ENSPPYG00000006153
LinkDB
Position
14
AA seq 733 aa
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKED
KEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTR
NPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKN
NIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKK
CLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKD
YCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGK
TLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCI
VTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSV
KDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPL
EGDDDTSRMEEVD
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgcctgaggaaacccagacgcaagaccaaccgatggaggaggaggaggttgagaccttc
gcctttcaggcagaaattgcccagttgatgtcattgatcatcaatactttctactcgaac
aaagagatttttctgagagagctcatttcaaattcatcagatgcattggacaaaatccgg
tatgaaagcttgacagatcccagtaaattagactctgggaaagagctgcatattaacctt
ataccgaacaaacaagatcgaaccctcactattgtggatactggaattggaatgaccaag
gctgacttgatcaataaccttggtactatcgccaagtctgggaccaaagcgttcatggaa
gctttgcaggctggtgcggatatctctatgattggccagttcggtgttggtttttattct
gcttatttggttgctgagaaagtaactgtgatcaccaaacataacgatgatgagcagtac
gcctgggagtcctcagcagggggatcattcacagtgaggacagacacaggtgaacctatg
ggtcgtggaacaaaggttatcctacacctgaaagaagaccaaactgagtacttagaggaa
cgaagaataaaggagattgtgaagaaacattctcagtttattggatatcccattactctt
tttgtggagaaggaacgtgataaagaagtcagcgatgatgaggctgaagaaaaggaagac
aaagaagaagaaaaagaaaaagaagagaaagagtcggaagacaaacctgaaattgaagat
gttggttctgatgaggaagaagaagaaaagaaggatggtgataagaagaagaagaaaaag
attaaggaaaagtacatcgaccaagaagaactcaacaaaacaaagcccatctggaccaga
aatcccgacgatattactaatgaggagtacggagaattctacaagagcttgaccaatgat
tgggaagatcacttggcagtgaagcatttttcagttgaaggacagttggaattcagagct
cttctatttgtcccacgacgtgctccttttgacctgtttgaaaacagaaagaaaaagaac
aacatcaaattgtatgtacgcagagttttcatcatggataactgtgaggagctaatccct
gaatatctgaatttcattagaggggtggtagactcagaggatctccctctaaacatttcc
cgtgagatgttgcaacaaagcaaaattttgaaagttatcaggaagaatttggtcaaaaaa
tgcttagaactttttactgaactggcggaagataaagagaactacaagaaattctatgag
cagttctctaaaaacataaagcttggaatacacgaagactctcaaaatcggaagaagctt
tcagagctgttaaggtactacacgtctgcctctggtgatgagatggtttctctcaaggac
tactgcaccagaatgaaggaaaaccagaaacatatctattatatcacaggtgagaccaag
gaccaggtagctaactcagcctttgtggaacgtcttcggaaacatggcttagaagtgatc
tatatgattgagcccattgatgagtactgtgtccaacagctgaaggaatttgaggggaag
actttagtgtcagtcaccaaagaaggcctggaacttccagaggatgaagaagagaaaaag
aaacaggaagagaaaaaaacaaagtttgagaacctctgcaaaatcatgaaagacatattg
gagaaaaaagttgaaaaggtggttgtgtcaaaccgattggtgacgtctccatgctgtatt
gtcacgagcacatacggctggacagcaaacatggagagaatcatgaaagctcaagcccta
agagacaactcaacaatgggttacatggcagccaagaaacacctggagataaaccctgac
cattccattattgagaccttaaggcaaaaggcagaggctgataagaacgacaagtctgtg
aaggatctggtcatcttgctttatgaaactgcgctcctgtcttctggcttcagtctggaa
gatccccagacacatgctaataggatctacaggatgatcaaacttggtctgggtattgat
gaagatgaccctactgctgatgataccagtgctgctgtaactgaagaaatgccgcccctc
gaaggagatgacgacacatcacgcatggaagaagtagactaa

KEGG   Pongo abelii (Sumatran orangutan): 100173428
Entry
100173428         CDS       T01416                                 

Gene name
HSP90AB1
Definition
(RefSeq) heat shock protein HSP 90-beta
  KO
K04079  molecular chaperone HtpG
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04141  Protein processing in endoplasmic reticulum
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04612  Antigen processing and presentation
pon04621  NOD-like receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04659  Th17 cell differentiation
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon05132  Salmonella infection
pon05200  Pathways in cancer
pon05215  Prostate cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100173428 (HSP90AB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100173428 (HSP90AB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100173428 (HSP90AB1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100173428 (HSP90AB1)
   04612 Antigen processing and presentation
    100173428 (HSP90AB1)
   04659 Th17 cell differentiation
    100173428 (HSP90AB1)
   04657 IL-17 signaling pathway
    100173428 (HSP90AB1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100173428 (HSP90AB1)
   04914 Progesterone-mediated oocyte maturation
    100173428 (HSP90AB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100173428 (HSP90AB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100173428 (HSP90AB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100173428 (HSP90AB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100173428 (HSP90AB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100173428 (HSP90AB1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pon03110]
    100173428 (HSP90AB1)
   04131 Membrane trafficking [BR:pon04131]
    100173428 (HSP90AB1)
   03051 Proteasome [BR:pon03051]
    100173428 (HSP90AB1)
   03029 Mitochondrial biogenesis [BR:pon03029]
    100173428 (HSP90AB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100173428 (HSP90AB1)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100173428 (HSP90AB1)
Chaperones and folding catalysts [BR:pon03110]
 Heat shock proteins
  HSP90
   100173428 (HSP90AB1)
Membrane trafficking [BR:pon04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100173428 (HSP90AB1)
Proteasome [BR:pon03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100173428 (HSP90AB1)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    100173428 (HSP90AB1)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100173428 (HSP90AB1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 100173428
NCBI-ProteinID: NP_001126444
Ensembl: ENSPPYG00000016655
UniProt: Q5R710
LinkDB
Position
6
AA seq 724 aa
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEEVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPSAAVPDEIPPLEGDEDASRM
EEVD
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgcctgaggaagtgcaccatggagaggaggaggtggagacttttgcctttcaggcagaa
attgcccaactcatgtccctcatcatcaataccttctattccaacaaggagattttcctt
cgggagttgatctctaatgcttctgatgccttggacaagattcgctatgagagcctgaca
gacccttcgaagttggacagtggtaaagaactgaaaattgacatcatccccaaccctcag
gaacgtaccctgactttggtagacacaggcattggcatgaccaaagctgatctcataaat
aatttgggaaccattgccaagtctggtactaaagcattcatggaggctcttcaggctggt
gcagacatctccatgattgggcagtttggtgttggcttttattctgcctacctggtagca
gagaaagtggttgtgatcacaaagcacaatgatgatgaacagtatgcttgggagtcttct
gctggaggttccttcactgtgcgtgctgaccatggtgagcccattggcaggggtaccaaa
gtgatcctccatcttaaagaagatcagacagagtacttagaagagaggcgggtcaaagaa
gtagtgaagaagcattctcagttcataggctatcccatcaccctttatttggagaaggaa
cgagagaaggaaattagtgatgatgaggcagaggaagagaaaggtgagaaagaagaggaa
gataaagatgatgaagaaaagcccaagatcgaagatgtgggttcagatgaggaggatgac
agcggtaaggataagaagaagaaaactaagaagatcaaagagaaatacattgatcaggaa
gaactaaacaagaccaagcctatttggaccagaaaccctgatgacatcacccaagaggag
tatggagaattctacaagagcctcaccaatgactgggaagaccacttggcagtcaagcac
ttttctgtagaaggtcagttggaatttagggcattgctattcattcctcgtcgggctccc
tttgacctttttgagaacaagaagaaaaagaacaacatcaaactctatgtccgccgtgtg
ttcatcatggacagctgtgatgaattgataccagagtatctcaattttatccgtggtgtg
gttgactctgaggatctgcccctgaacatctcccgagaaatgctccagcagagcaaaatc
ttgaaagtcattcgcaaaaacattgttaagaagtgccttgagctcttctctgagctggca
gaagacaaggagaattacaagaaattctatgaggcattctctaaaaatctcaagcttgga
atccatgaagactccactaaccgccgccgcctgtctgagctgctgcgctatcatacctcc
cagtctggagatgagatgacatctctgtcagagtatgtttctcgcatgaaggagacacag
aagtccatctattacatcactggtgagagcaaagagcaggtggccaactcagcttttgtg
gagcgagtgcggaaacggggcttcgaggtggtatatatgaccgagcccattgatgagtac
tgtgtgcagcagctcaaggaatttgatgggaagagcctggtttcagttaccaaggagggt
ctggagctgcctgaggatgaagaggagaagaagaaaatggaagagagtaaggcaaagttt
gagaacctctgcaagctcatgaaagaaatcttagataagaaggttgaggaggtgaccatc
tccaatagacttgtgtcttcaccttgctgcattgtgaccagcacctacggctggacagcc
aatatggagcggatcatgaaagcccaggcacttcgggacaactccaccatgggctatatg
atggccaaaaagcacctggagatcaaccctgaccaccccattgtggagacgctgcggcag
aaggctgaggccgacaagaatgataaggcagttaaggacctggtggtgctgctgtttgaa
accgccctgctatcttctggcttttccctcgaggatccccagacccactcgaaccgcatc
taccgcatgatcaagctaggtctaggtattgatgaagatgaagtggcagcagaggaaccc
agtgctgcagttcctgatgagatcccccctcttgagggcgatgaggatgcgtctcgcatg
gaagaagtcgattag

KEGG   Pongo abelii (Sumatran orangutan): 100174651
Entry
100174651         CDS       T01416                                 

Gene name
HSP90B1
Definition
(RefSeq) endoplasmin precursor
  KO
K09487  heat shock protein 90kDa beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04141  Protein processing in endoplasmic reticulum
pon04151  PI3K-Akt signaling pathway
pon04657  IL-17 signaling pathway
pon04915  Estrogen signaling pathway
pon04918  Thyroid hormone synthesis
pon05132  Salmonella infection
pon05200  Pathways in cancer
pon05215  Prostate cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100174651 (HSP90B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100174651 (HSP90B1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100174651 (HSP90B1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100174651 (HSP90B1)
   04918 Thyroid hormone synthesis
    100174651 (HSP90B1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100174651 (HSP90B1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100174651 (HSP90B1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100174651 (HSP90B1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100174651 (HSP90B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pon03110]
    100174651 (HSP90B1)
Chaperones and folding catalysts [BR:pon03110]
 Heat shock proteins
  HSP90
   100174651 (HSP90B1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 MH1
Other DBs
NCBI-GeneID: 100174651
NCBI-ProteinID: NP_001127573
UniProt: Q5R6F7
LinkDB
Position
12
AA seq 804 aa
MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFCSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNT
LGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAK
EEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYK
SFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD
DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKY
NDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYF
MAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDE
SEKTKESREAIEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMER
IMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVLFET
ATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETTEDTTEDTEQDEDE
EMDVGTDEEEQETAKESTAEKDEL
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgagggccctgtgggtgctgggcctctgctgcgtcctgctgaccttcgggtcggtcaga
gctgacgatgaagttgatgtggatggtacagtagaagaggatctgggtaaaagtagagaa
ggctcaaggacggatgatgaagtagtacagagagaggaagaagctattcagttggatgga
ttaaatgcatcacaaataagagaacttagagagaagtcagaaaagtttgccttccaagcc
gaagttaacagaatgatgaaacttatcatcaattcattgtataaaaataaagagattttc
ctgagagaactgatttcaaatgcttccgacgctttagataagataaggctaatatcactg
actgatgaaaatgctctttctggaaatgaggaactaacagtcaaaattaagtgtgataag
gagaagaacctgctgcatgtcacagacaccggtgtaggaatgaccagagaagagttggtt
aaaaacctcggtaccatagccaaatctgggacaagcgagtttttaaacaaaatgactgaa
gcacaggaagatggccagtcaacttctgaattgattggccagtttggtgtcggtttctgt
tccgcctttcttgtagcagataaggttattgtcacttcaaaacacaacaacgatacccag
cacatctgggagtctgactccaatgaattttctgtaattgctgacccaagaggaaacact
ctaggacggggaacgacaattacccttgtcttaaaagaagaagcatctgattaccttgaa
ttggatacaattaaaaatctcgtcaaaaaatattcacagttcataaactttcctatttat
gtatggagcagcaagactgaaactgttgaggagcccatggaggaagaagaagcagccaaa
gaagagaaagaagaatctgatgatgaagctgcagtagaggaagaagaagaagaaaagaaa
ccaaagactaaaaaagttgaaaaaactgtctgggactgggaacttatgaatgatatcaaa
ccaatatggcagagaccatcaaaagaagtagaagaagatgaatacaaagctttctacaaa
tcattttcaaaggaaagtgatgaccccatggcttatattcactttactgctgaaggggaa
gttaccttcaaatcaattttatttgtacccacatctgctccacgtggtctatttgacgaa
tatggatctaaaaagagcgattacattaagctctatgtgcgccgtgtattcatcacagac
gacttccatgatatgatgcctaaataccttaattttgtcaagggtgtggtggactcagat
gatctccccttgaatgtttcccgcgagactcttcagcaacataaactgcttaaggtgatt
aggaagaagcttgttcgtaaaacgctggacatgatcaagaagattgctgatgataaatac
aatgatactttttggaaagaatttggtaccaacatcaagcttggtgtgattgaagaccac
tcgaatcgaacacgtcttgctaaacttcttaggttccagtcttctcatcatccaaccgac
attactagcctagaccagtatgtggaaagaatgaaggaaaaacaagacaaaatctacttc
atggctgggtccagcagaaaagaggctgaatcttctccatttgttgagcgacttctgaaa
aagggctatgaagttatttacctcacagaacctgtggatgaatactgtattcaggctctt
cccgaatttgatgggaagaggttccagaatgttgccaaggaaggagtgaagtttgatgaa
agtgagaaaactaaggagagtcgtgaagcaattgagaaagaatttgagcctctgctgaat
tggatgaaagataaagcccttaaggacaagattgaaaaggctgtggtgtctcagcgcctg
acagaatctccgtgtgctttggtggccagccagtacggatggtctggcaacatggagaga
atcatgaaagcacaagcgtaccaaacgggcaaggacatctctacaaattactatgcaagt
cagaagaaaacatttgaaattaatcccagacacccgctgatcagagacatgcttcgacga
attaaggaagatgaagatgataaaacagttttggatcttgctgtggttttgtttgaaaca
gcaacgcttcggtcagggtatcttttaccagacactaaagcatatggagatagaatagaa
agaatgcttcgcctcagtttgaacattgaccctgatgcaaaggtggaagaagagcccgaa
gaagaacctgaagagacaacagaagacacaacagaagacacagagcaagacgaagatgaa
gaaatggatgtgggaacagatgaagaagaacaagaaacagcaaaggaatctacagctgaa
aaagatgaattgtaa

KEGG   Pongo abelii (Sumatran orangutan): 100445801
Entry
100445801         CDS       T01416                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: putative heat shock protein HSP 90-alpha A5
  KO
K04079  molecular chaperone HtpG
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04141  Protein processing in endoplasmic reticulum
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04612  Antigen processing and presentation
pon04621  NOD-like receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04659  Th17 cell differentiation
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon05132  Salmonella infection
pon05200  Pathways in cancer
pon05215  Prostate cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100445801
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100445801
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100445801
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100445801
   04612 Antigen processing and presentation
    100445801
   04659 Th17 cell differentiation
    100445801
   04657 IL-17 signaling pathway
    100445801
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100445801
   04914 Progesterone-mediated oocyte maturation
    100445801
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100445801
  09162 Cancer: specific types
   05215 Prostate cancer
    100445801
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100445801
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100445801
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100445801
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pon03110]
    100445801
   04131 Membrane trafficking [BR:pon04131]
    100445801
   03051 Proteasome [BR:pon03051]
    100445801
   03029 Mitochondrial biogenesis [BR:pon03029]
    100445801
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100445801
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100445801
Chaperones and folding catalysts [BR:pon03110]
 Heat shock proteins
  HSP90
   100445801
Membrane trafficking [BR:pon04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100445801
Proteasome [BR:pon03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100445801
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    100445801
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100445801
SSDB
Motif
Pfam: HSP90 DUF4375
Other DBs
NCBI-GeneID: 100445801
NCBI-ProteinID: XP_009237876
LinkDB
Position
3
AA seq 331 aa
MGFHHVGQAGLELLTSGYPALERRPTEYLEERRIKEIVEKHSQFIGYPITVFVEKKRDKE
VSDDEAEEKEDKRKKKKESDDKPEIEDVGSDEEEEKKDADKKKKKSKETYTDQELNKTKP
IWTRNPDAITNEEYGEFHQSLTNDWEDHLAVKHFSVEGQLEFRRALFANQKHIYYITGET
KDQIANSAFVECLQNHGLEVISMIELIDEYCVQQLKEFESKTVVSVAKEGLELPEDEEEK
KKQEEKKTKFENLCKIMKDMLEKKIKKMVVSNCMEDPQTHTNKIYRMIKLGLGIDEDDPT
ADDINAAVTKEMPPLRGGDDTSRMKEVGGSG
NT seq 996 nt   +upstreamnt  +downstreamnt
atggggtttcaccatgttggccaagctggtcttgaactgctgacctcagggtaccctgca
cttgaaagaagacctactgagtatttggaggaaagaagaataaaagagattgtggagaag
cattctcagtttattggctatcccattactgtttttgtggagaagaaacgtgataaagaa
gtcagtgatgatgaggctgaagaaaaggaagataagaggaagaaaaagaaagagtccgat
gacaaacctgaaattgaagatgttggttctgatgaagaagaagaaaagaaggatgctgac
aagaagaagaagaaaagtaaggaaacgtacactgatcaagaactcaacaaaacaaagcct
atctggaccagaaatcctgacgctattactaatgaggagtatggagagttccatcagagc
ttgaccaatgactgggaagatcacttggcagtgaagcacttttcagttgaaggacagttg
gaatttagaagagctctttttgcaaaccagaaacatatctactacattacaggtgagacc
aaggaccaaatagctaactcagcctttgtagaatgtcttcagaaccatggcttagaagtg
atctctatgatcgagttgattgatgagtactgtgtccagcagctgaaggagtttgagagt
aagactgtagtgtcagttgccaaagagggtttggaacttccagaagatgaagaagaaaaa
aagaaacaggaagagaaaaaaacaaagtttgagaacctctgcaaaatcatgaaagacatg
ttggagaaaaaaatcaaaaagatggttgtgtcaaactgtatggaagaccctcagacacat
actaacaagatctataggatgatcaaacttggtctgggtattgatgaagatgatcctact
gctgatgatatcaatgctgctgtaactaaagaaatgccgcccctcagaggaggtgatgac
acatcacgcatgaaagaagtaggcggctctggctga

KEGG   Pongo abelii (Sumatran orangutan): 100447247
Entry
100447247         CDS       T01416                                 

Definition
(RefSeq) heat shock protein HSP 90-beta-like
  KO
K04079  molecular chaperone HtpG
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04141  Protein processing in endoplasmic reticulum
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04612  Antigen processing and presentation
pon04621  NOD-like receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04659  Th17 cell differentiation
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon05132  Salmonella infection
pon05200  Pathways in cancer
pon05215  Prostate cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100447247
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100447247
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100447247
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100447247
   04612 Antigen processing and presentation
    100447247
   04659 Th17 cell differentiation
    100447247
   04657 IL-17 signaling pathway
    100447247
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100447247
   04914 Progesterone-mediated oocyte maturation
    100447247
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100447247
  09162 Cancer: specific types
   05215 Prostate cancer
    100447247
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100447247
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100447247
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100447247
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pon03110]
    100447247
   04131 Membrane trafficking [BR:pon04131]
    100447247
   03051 Proteasome [BR:pon03051]
    100447247
   03029 Mitochondrial biogenesis [BR:pon03029]
    100447247
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100447247
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100447247
Chaperones and folding catalysts [BR:pon03110]
 Heat shock proteins
  HSP90
   100447247
Membrane trafficking [BR:pon04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100447247
Proteasome [BR:pon03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100447247
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    100447247
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100447247
SSDB
Motif
Pfam: HSP90
Other DBs
NCBI-GeneID: 100447247
NCBI-ProteinID: XP_024086782
Ensembl: ENSPPYG00000005454
LinkDB
Position
13
AA seq 361 aa
MWETFELPRDLLNGFDPNADSDMDNKVPTEVVSDGDEELVGNWSKGIHPDFGGHRHLRNK
ADFINNLGTIAKSETKGFMEALQAGADISMIVSLIENVRSNEEDDSGKDKKKKTEKIKEK
YIDQEELNKTKTIWTRNHDYITQEYGEFCNSHTNDWEDHLAVKHFSIEGQLEFRALLFIP
YWAPFDLFENNKNKDTIKLYVLHVFIVHSCDELISEDLNFICEDKENYKKFYEAFSKNLM
FGIPENSPNCFQSRDGMTSLSEYVSCMKETWKSTYYITVESNEQVASSAFMDHYGADCES
PGTLGQLYDGLLDGQRAPGDQRDHTVVEMLWQKAEADKNDKAVKDRMVLLLKTKLLFWLL
P
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtgggaaacttttgaacttcctagagacttgttgaatggctttgacccaaatgctgat
agtgatatggacaataaagtcccgactgaggtggtgtcagatggagatgaggaacttgtt
gggaactggagcaaaggaatacaccctgactttggtggacacaggcatttgcgtaacaaa
gctgatttcataaataatttgggaaccattgccaagtctgagactaaaggatttatggag
gctctacaggctggtgcagacatctccatgattgtcagtttgattgaaaatgtgcgttca
aatgaggaggatgacagtggtaaggataagaaaaagaaaaccgagaagatcaaagagaaa
tacattgatcaggaagaactaaacaagaccaagactatttggacaagaaaccatgattac
atcacccaggagtatggagaattctgtaacagccacactaatgactgggaagatcacttg
gcagtcaagcatttctctatagaaggtcagttggaattcagggcattgttgttcatccct
tattgggctccttttgacctctttgagaacaataagaataaagacaccatcaaactctat
gtccttcatgtgttcatcgtgcacagctgtgatgagttgatatcagaggatctcaacttt
atctgtgaagacaaagagaattacaagaaattctatgaggcattctctaaaaatctaatg
tttggaatccccgagaactcccctaactgcttccagtctcgagatgggatgacatctctg
tcagaatatgtctcttgcatgaaggagacatggaaatccacctactacatcactgttgag
agcaacgaacaggtggccagctctgctttcatggaccattatggagcagattgtgaaagc
ccaggcactttgggacaactctatgatgggttacttgatggccaaagagcacctggagat
caacgtgaccacaccgttgtggagatgctgtggcagaaggctgaggcggataagaacgac
aaggctgtcaaggaccgcatggtgctgctgttgaaaaccaagctgctcttctggcttctt
ccttga

DBGET integrated database retrieval system