KEGG   Pongo abelii (Sumatran orangutan): 100173253Help
Entry
100173253         CDS       T01416                                 

Gene name
PCSK1
Definition
(RefSeq) neuroendocrine convertase 1 precursor
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pon01002]
    100173253 (PCSK1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pon03110]
    100173253 (PCSK1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     100173253 (PCSK1)
Peptidases [BR:pon01002]
 Serine Peptidases
  Family S8: subtilisin family
   100173253 (PCSK1)
Chaperones and folding catalysts [BR:pon03110]
 Intramolecular chaperones
  Subtilisin family
   100173253 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert Peptidase_S8_N OmpA_membrane
Motif
Other DBs
NCBI-GeneID: 100173253
NCBI-ProteinID: NP_001126279
Ensembl: ENSPPYG00000015648
UniProt: Q5R7S5
LinkDB All DBs
Position
5
AA seq 753 aa AA seqDB search
MERRAWSLQCTAFVVFCAWCALNSAKAKRQFVNEWAAEIPGGPEAALAIAEELGYDLLGQ
IGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRSALRDSALNL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPAWQKGITGKGVVITVLDDGLEWNHTDIYAN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLAEPRTWRSVPEKKECVVKDNDFEPRALK
ANGEVIIEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPIGTWTLRITDMSGRIQNEGRIVNWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKMVDPGEEQPTQENPKEDTLVSKSPSSSSVGGRRDELEE
GAPSEAMLRLLQSAFSKNSSPKQSPKKSPSAKPNIPYENFYEALEKLNKPSQLKDSEDSL
YDDYVDVFYNTKPYKHRDDRLLQALVDILNEEN
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaagagcctggagtctgcagtgcactgctttcgtcgtcttttgcgcttggtgt
gcactgaacagtgcaaaagcgaaaaggcaatttgtcaatgaatgggcagcggagatcccc
ggcggcccggaagcagccttggccatcgccgaggagctgggctatgaccttttgggtcag
attggttcacttgaaaatcactacttattcaaacataaaaaccaccccagaaggtctcga
aggagtgcctttcatatcactaagagattatctgatgatgatcgtgtgatatgggctgaa
caacagtatgaaaaagaaagaagtaaacgttcagctctaagggactcagcactaaatctc
ttcaatgatcccatgtggaatcagcaatggtacttgcaagataccaggatgacggcagcc
ctgcccaagctggaccttcatgtgatacctgcttggcaaaaaggcattacgggcaaagga
gttgttatcaccgtactggatgatggtttggagtggaatcacacggacatttatgccaac
tatgatccagaggctagctatgattttaatgataatgaccatgatccatttccccgatac
gatcccacaaatgagaacaaacatgggaccagatgtgcaggagaaattgccatgcaagca
aataatcacaaatgcggggttggagttgcatacaattccaaagttggaggcataagaatg
ctggatggcattgtgacagatgctattgaggccagttcaattggattcaatcctggacac
gtggatatttacagtgcaagctggggccctaatgatgatgggaaaactgtggaggggcct
ggccggctagcccagaaggcttttgaatatggtgtcaaacagggaagacaggggaagggg
tccatcttcgtctgggcttcgggaaatggggggcgtcagggagataattgtgactgtgat
ggctacacagacagcatctacaccatctccatcagcagtgcctcccagcaaggcctatcc
ccctggtacgctgagaagtgctcctccacactggccacctcttacagcagcggggattac
accgaccagagaatcacgagcgctgacctgcacaatgactgcacggagacgcacacgggc
acatcggcctctgcacctctggctgctggcatcttcgctctggccctggaagcaaaccca
aatctcacctggcgagatatgcagcacctggttgtctggacctctgagtatgacccgctg
gccaataaccctggatggaaaaagaatggagcaggcttgatggtgaatagtcgatttgga
tttggcttgctaaatgccaaagctctggtggatttagctgagcccaggacctggaggagt
gtgcctgagaagaaagagtgtgttgtaaaggacaatgactttgagcccagagccctgaaa
gctaatggagaagttatcattgaaattccaacaagagcttgtgaaggacaagaaaatgct
atcaagtccctggagcatgtacaatttgaagcaacaattgaatattcccgaagaggagac
cttcatgtcacacttacttctgctgctggaactagcactgtgctgttggctgaaagagaa
cgggatacatctcctaatggctttaagaattgggacttcatgtctgttcacacatgggga
gagaaccctataggtacttggactttgcgaattacagacatgtctggaagaattcaaaat
gaaggaagaattgtgaactggaagctgattttgcatgggacctcttctcagccagagcat
atgaagcagcctcgtgtgtacacgtcctacaacaccgttcagaatgacagaagaggggtg
gagaagatggtggatccaggggaggagcagcccacacaagagaaccctaaggaggatacc
ctggtgtccaaaagccccagcagcagcagcgtaggaggccggagggatgagttggaggag
ggagccccttccgaggccatgctgagactcctgcaaagtgctttcagtaaaaactcatcg
ccaaagcaatcaccaaagaagtccccaagtgcaaagcccaacatcccttatgaaaacttc
tacgaagccctggaaaagctgaacaaaccttcccagcttaaagactctgaagacagtctg
tatgatgactatgttgatgttttttataacactaaaccttacaagcacagagacgaccgg
ctgcttcaagctctggtggacattctgaatgaggaaaattaa

DBGET integrated database retrieval system