KEGG   Pongo abelii (Sumatran orangutan): 100173269
Entry
100173269         CDS       T01416                                 

Gene name
BID
Definition
(RefSeq) BH3-interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04071  Sphingolipid signaling pathway
pon04115  p53 signaling pathway
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04217  Necroptosis
pon04650  Natural killer cell mediated cytotoxicity
pon04932  Non-alcoholic fatty liver disease
pon05010  Alzheimer disease
pon05014  Amyotrophic lateral sclerosis
pon05022  Pathways of neurodegeneration - multiple diseases
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100173269 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100173269 (BID)
   04215 Apoptosis - multiple species
    100173269 (BID)
   04217 Necroptosis
    100173269 (BID)
   04115 p53 signaling pathway
    100173269 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100173269 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100173269 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100173269 (BID)
   05014 Amyotrophic lateral sclerosis
    100173269 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    100173269 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100173269 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100173269 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100173269 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100173269 (BID)
   05161 Hepatitis B
    100173269 (BID)
   05160 Hepatitis C
    100173269 (BID)
   05164 Influenza A
    100173269 (BID)
   05162 Measles
    100173269 (BID)
   05168 Herpes simplex virus 1 infection
    100173269 (BID)
   05163 Human cytomegalovirus infection
    100173269 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100173269 (BID)
   05169 Epstein-Barr virus infection
    100173269 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100173269 (BID)
SSDB
Motif
Pfam: BID Rubis-subs-bind CRM1_C Bcl-2
Other DBs
NCBI-GeneID: 100173269
NCBI-ProteinID: NP_001126293
UniProt: Q5R7P9
LinkDB
Position
22
AA seq 99 aa
MDRSIPPGLVNGLALQLRNTSQSEEDRNRDLATALEQLLQAYPTDMEKEKTMLVLALLLA
KKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
NT seq 300 nt   +upstreamnt  +downstreamnt
atggaccgtagcatccctccgggcctggtgaacggcctggccctgcagctcaggaacacc
agccagtcagaggaggaccggaacagggacctggccactgccctggagcagctgctgcag
gcctaccctacagacatggagaaggagaagaccatgctggtgctggccctgctgctggcc
aagaaggtggccagtcacacaccgtccttgctgcgtgatgtctttcacacaacggtgaat
tttattaaccagaacctacgcacctacgtgaggagcttagccagaaatgggatggactga

DBGET integrated database retrieval system