KEGG   Pongo abelii (Sumatran orangutan): 100173313
Entry
100173313         CDS       T01416                                 

Gene name
PXN
Definition
(RefSeq) paxillin
  KO
K05760  paxillin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04062  Chemokine signaling pathway
pon04370  VEGF signaling pathway
pon04510  Focal adhesion
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05135  Yersinia infection
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100173313 (PXN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100173313 (PXN)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100173313 (PXN)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100173313 (PXN)
   04062 Chemokine signaling pathway
    100173313 (PXN)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100173313 (PXN)
   05203 Viral carcinogenesis
    100173313 (PXN)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100173313 (PXN)
   05100 Bacterial invasion of epithelial cells
    100173313 (PXN)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100173313 (PXN)
   05163 Human cytomegalovirus infection
    100173313 (PXN)
   05165 Human papillomavirus infection
    100173313 (PXN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100173313 (PXN)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 LIM domain-containing proteins
  Paxillin family proteins
   100173313 (PXN)
SSDB
Motif
Pfam: Paxillin LIM
Other DBs
NCBI-GeneID: 100173313
NCBI-ProteinID: NP_001126332
Ensembl: ENSPPYG00000005023
UniProt: Q5R7I1
LinkDB
Position
12
AA seq 591 aa
MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNG
TILDPLDQWQPSGSRFIHQQPQSSSPVYGSSAKTSSVSNPQDGVGSPCSRVGEEEHVYSF
PNKQKSAESSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSGPPLPGALSPH
YGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQG
EMSSPQRVTSTQQQTRISASSATRELDELMASLSDFRIQGLEQRADGERCWAADWPRDGG
RSSPGGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGA
CKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYC
NGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCA
RAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQK
PITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggacgacctcgacgccctgctggcggacttggagtctaccacctcccacatctccaaa
cggcctgtgttcttgtcggaggagaccccctactcatacccaactggaaaccacacatac
caggagattgccgtgccaccccccgtccccccacccccgtccagcgaggccctcaatggc
acaatccttgaccccttagaccagtggcagcccagtggctcccgattcatccaccagcag
cctcagtcctcatcacctgtgtacggctccagtgccaaaacttccagtgtctccaaccct
caggacggtgttggctctccgtgctcccgagtgggtgaggaggagcacgtctacagcttc
cccaacaagcagaaatcagccgagtcttcacccaccgtaatgagcacgtccctgggcagc
aacctttctgaactcgaccgcctgctgctggaactgaacgccgtgcagcataacccgcca
ggcttccctgcagatgaggccaactcaggtcccccgcttcctggggccctgagcccccac
tatggtgtcccagagactaacagccccttgggaggcaaagctgggcccctgacgaaagag
aagcctaagcggaatgggggccggggcctggaggacgtgcggcccagtgtggagagtctc
ttggatgaactggagagctccgtgcccagccccgtccctgccatcactgtgaaccagggc
gagatgagcagcccgcagcgtgtcacctccacccaacagcagacgcgcatctcagcctcc
tctgccaccagggagctggacgagctgatggcttcgctgtcggatttcaggatccagggc
ctggagcaaagagcagatggggagcggtgctgggcggccgactggcctcgggacggcggg
cggagcagccctggagggcaggacgagggagggttcatggcccaggggaagacagggagc
agctcaccccctggggggcccccgaagcccgggagccagctagacagcatgctggggagc
ctgcagtccgacctgaacaagctgggggttgccacggtcgccaaaggagtctgtggggcc
tgcaagaaacccatcgccgggcaggttgtgaccgccatggggaagacgtggcaccccgag
cacttcgtctgcacccactgccaggaggagatcggatcccggaacttcttcgagcgggat
ggacagccctactgtgaaaaggactaccacaacctcttctccccgcgctgctactactgc
aacggccccatcctggataaagtggtgacagcccttgaccggacgtggcaccctgaacac
ttcttctgtgcccagtgtggagccttctttggtcccgaagggttccacgagaaggacggc
aaggcctactgccgcaaggactacttcgacatgttcgcacccaagtgtggcggctgcgcc
cgggccatcctggagaactatatctcagccctcaacacgctgtggcatcctgagtgcttc
gtgtgccgggaatgcttcacgccatttgtcaacggcagcttctttgagcatgacgggcag
ccctactgtgaggtgcactaccatgagcggcgcggctcgctgtgctctggctgccagaag
cccatcaccggccgctgcatcaccgccatggccaagaagttccaccccgagcacttcgtc
tgtgccttctgcctcaagcagctcaacaagggcaccttcaaggagcagaacgacaagcct
tactgtcagaactgcttcctcaagctcttctgctag

DBGET integrated database retrieval system