KEGG   Pongo abelii (Sumatran orangutan): 100173365Help
Entry
100173365         CDS       T01416                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase precursor
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00052  Galactose metabolism
pon00500  Starch and sucrose metabolism
pon01100  Metabolic pathways
pon04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100173365 (GAA)
   00500 Starch and sucrose metabolism
    100173365 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100173365 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100173365 (GAA)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100173365 (GAA)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100173365 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100173365
NCBI-ProteinID: NP_001126384
Ensembl: ENSPPYG00000008713
UniProt: Q5R7A9
LinkDB All DBs
Position
17
AA seq 952 aa AA seqDB search
MRVRHPPCSRRLLAICALVSLATAALLGHILLHDFLLVPRELSGSSPVLEETHPAHQQGA
SRPGPRDAQAHLGRPRAVPTQCDVPPNSRFDCAPDKAITREQCDARGCCYIPAKQGLRGA
QMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLH
FTIKDPANRRYEVPLETPRVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLF
FADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRVTLWNRDLAPTPGANLYGSHPFYLA
LEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVRQYLDVVGY
PFMPPYWGLGFHLCRWGYSSTAITSQVVENMTRAHFPLDVQWNDLDYMDARRDFTFNKDG
FRDFPAMVRELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETSQPLIGKV
WPGSTAFPDFTNPAALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPDNELEN
PPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISR
STFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVR
WTQLGAFYPFMRNHNGLLNLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAG
ETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGIWYDLQTVPI
EALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQP
MALAVALTKGGEARGELFWDDGESLEVLERGAYTQVLFLARNNTIVNELVHVTSEGAGLQ
LQKVTVLGVATTPQQVLSNGVPVSNFTYSPDTKVLDIPVSLLMAEQFLISWS
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgagagtgaggcacccgccctgctcccgccggctgctggccatctgcgcccttgtgtcc
ttggccactgctgcactcctggggcacatcttgctccatgattttctgctggttccccga
gagctgagtggctcctccccagtcctggaggagactcacccagctcaccagcagggagcc
agcaggccagggccccgggatgcccaggcacacctcggccgtcccagagcagtgcccaca
cagtgcgacgtcccccccaacagccgctttgactgtgcccctgacaaggccatcacccgg
gaacagtgcgatgcccgtggctgctgctacatccctgcaaagcaggggctgcggggagcc
cagatggggcagccctggtgcttcttcccacccagctaccccagctacaagctggagaac
ctgagctcctctgaaatgggctacacggccaccctgacccgtaccacccccaccttcttc
cccaaggacatcctgaccttgcggctggacgtgatgatggagactgagaaccgcctccac
ttcacgatcaaagatcccgctaacaggcgctacgaggtgcccttggagaccccgcgtgtc
cacagccgggcaccgtccccgctctacagtgtggagttctccgaggagcccttcggggtg
atcgtgcgccggcagctggacggccgcgtgctgctgaacacgacggtggcacccctgttc
tttgcggaccagttccttcagctgtccacctcgctgccctcgcagtacatcacaggcctc
gccgagcacctcagtcccctgatgctcagcaccagctggaccagggtcaccctgtggaac
cgggacctcgcgcccacgcctggtgcaaacctctacgggtctcaccctttctatctggcg
ctggaggatggcgggtcggcacacggggtgttcctgctgaacagcaatgccatggatgtg
gtcctgcagccgagccccgcccttagctggaggtcgacaggtgggatcctggatgtctac
atcttcctgggcccggagcccaagagcgtggtgcggcagtacctggacgttgtgggatac
ccgttcatgccgccatactggggcctgggcttccacctgtgccgctggggctactcctcc
accgccatcaccagccaggtggtggagaacatgaccagggcccacttccccctggacgtg
cagtggaacgacctggattacatggacgcccgcagggacttcacgttcaacaaggatggc
ttccgggacttcccggccatggtgcgggagctgcaccagggcggccggcgctacatgatg
atcgtggatcctgccatcagcagctcgggccctgcggggagctacaggccctacgacgag
ggtctgcggcggggggtcttcatcaccaacgagaccagccagccgctgattgggaaggta
tggcccgggtccactgccttccccgacttcaccaaccccgcagccctggcctggtgggag
gacatggtggctgagttccatgaccaggtgccgttcgacggcatgtggattgacatgaac
gagccttccaacttcatcaggggctctgaggacggctgccccgacaatgagctggagaac
ccaccctacgtgcctggggtggttggggggaccctccaggcggccaccatctgtgcctcc
agccaccagttcctctccacacactacaacctgcacaacctctatggcctgaccgaagcc
atcgcctcccacagggcactggtgaaggctcgggggacacgtccatttgtgatctcccgc
tcgacctttgctggccacggccgatatgccggccactggacgggggacgtgtggagctcc
tgggagcagctcgcctcctccgtgccagaaatcctgcagtttaacctgctgggggtgcct
ctggtcggggccgacgtctgcggcttcctgggcaacacctcagaggagctgtgtgtgcgc
tggacccagctgggggccttctaccccttcatgcggaaccacaacggcctgctcaatctg
ccccaggagccatacagcttcagcgagccagcccagcaggcgatgaggaaggccctcacc
ctgcgctacgcactcctcccccatctctacacgctgttccaccaggcccacgttgccggg
gagaccgtggcccggcccctcttcctggagttccccaaggactccagcacctggactgtg
gaccaccagctcctgtggggggaggccctgctcatcaccccagtgctccaggccgggaag
gccgaagtgactggctacttccccctgggcatatggtacgacctgcagacggtgccaata
gaggcccttggcagcctcccgcccccacctgcagctccccgtgagccagccatccacagc
gaggggcagtgggtgacgctgccggcccccctggacaccatcaacgtccacctccgggct
gggtacatcatccccctgcagggccctggcctcacaaccacagagtcccgccagcagccc
atggccctggctgtggccctgaccaagggtggggaggcccgaggagagctgttctgggat
gatggagagagcctggaagtgctggagcgaggggcctacacacaggtcctcttcctggcc
aggaataacacgattgtgaatgagctggtacatgtgaccagtgagggagctggcctgcag
ctgcagaaggtgactgtcctgggcgtggccacgacgccccagcaggtcctctccaacggc
gtccctgtctccaacttcacctacagccccgacaccaaggtcctggacatccctgtctcg
ctgttgatggcggagcagtttctcatcagctggtcttag

DBGET integrated database retrieval system