KEGG   Pongo abelii (Sumatran orangutan): 100173387
Entry
100173387         CDS       T01416                                 

Gene name
GNA12
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-12
  KO
K04346  guanine nucleotide-binding protein subunit alpha-12
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04270  Vascular smooth muscle contraction
pon04730  Long-term depression
pon04810  Regulation of actin cytoskeleton
pon04928  Parathyroid hormone synthesis, secretion and action
pon05163  Human cytomegalovirus infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100173387 (GNA12)
   04072 Phospholipase D signaling pathway
    100173387 (GNA12)
   04071 Sphingolipid signaling pathway
    100173387 (GNA12)
   04022 cGMP-PKG signaling pathway
    100173387 (GNA12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100173387 (GNA12)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100173387 (GNA12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100173387 (GNA12)
  09156 Nervous system
   04730 Long-term depression
    100173387 (GNA12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100173387 (GNA12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100173387 (GNA12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100173387 (GNA12)
   04031 GTP-binding proteins [BR:pon04031]
    100173387 (GNA12)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   100173387 (GNA12)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    100173387 (GNA12)
SSDB
Motif
Pfam: G-alpha Arf GTP_EFTU
Other DBs
NCBI-GeneID: 100173387
NCBI-ProteinID: NP_001126404
UniProt: Q5R777
LinkDB
Position
7
AA seq 157 aa
MVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNK
LFFNVSIILFLNKMDLLVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRRNRSK
PLFHHFTTAIDTENVRFVFHAVKDTILQENLKDIMLQ
NT seq 474 nt   +upstreamnt  +downstreamnt
atggtagatgtgggcggccagcggtcccagcgccagaagtggttccagtgcttcgacggg
atcacgtccatcctgttcatggtctcttccagcgagtacgaccaggtcctcatggaggac
aggcgcaccaaccggctggtagagtccatgaacatcttcgagaccatcgtcaacaacaag
ctcttcttcaacgtctccatcattctcttcctcaacaagatggacctcctggtggagaag
gtgaagaccgtgagcatcaagaagcacttcccggacttcaggggcgacccgcacaggctg
gaggacgtccagcgctacctggtccagtgcttcgacaggaagagacggaaccgcagcaag
ccgctcttccaccacttcaccaccgccatcgacaccgagaacgtccgcttcgtgttccat
gctgtgaaagacaccatcctgcaggagaacctgaaggacatcatgctgcagtga

KEGG   Pongo abelii (Sumatran orangutan): 100461065
Entry
100461065         CDS       T01416                                 

Gene name
GNA13
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04611  Platelet activation
pon04730  Long-term depression
pon04810  Regulation of actin cytoskeleton
pon04928  Parathyroid hormone synthesis, secretion and action
pon05163  Human cytomegalovirus infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100461065 (GNA13)
   04072 Phospholipase D signaling pathway
    100461065 (GNA13)
   04071 Sphingolipid signaling pathway
    100461065 (GNA13)
   04022 cGMP-PKG signaling pathway
    100461065 (GNA13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100461065 (GNA13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100461065 (GNA13)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100461065 (GNA13)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100461065 (GNA13)
  09156 Nervous system
   04730 Long-term depression
    100461065 (GNA13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100461065 (GNA13)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100461065 (GNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100461065 (GNA13)
   04031 GTP-binding proteins [BR:pon04031]
    100461065 (GNA13)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100461065 (GNA13)
  Exosomal proteins of colorectal cancer cells
   100461065 (GNA13)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    100461065 (GNA13)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 100461065
NCBI-ProteinID: XP_002827779
Ensembl: ENSPPYG00000008552
UniProt: A0A6D2XJ24 H2NUH1
LinkDB
Position
17
AA seq 377 aa
MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGENSNQQHGD
KMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDN
LDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcggacttcctgccgtcgcggtccgtgctgtccgtgtgcttccccggctgcctgctg
acgagtggcgaggccgagcagcagcgcaagtccaaggagatcgacaaatgcctgtctcgg
gaaaagacctatgtgaagcggctggtgaagatcctgctgctgggcgcgggcgagagcggc
aagtccaccttcctgaagcagatgcggatcatccacgggcaggacttcgaccagcgcgcg
cgcgaggagttccgccccaccatttacagcaacgtgatcaaaggtatgagggtgctggtt
gatgctcgagagaagcttcatattccctggggagaaaactcaaaccagcaacatggagat
aagatgatgtcatttgatacccgggcccccatggcagcccaaggaatggtggaaacaagg
gttttcttacaatatcttcctgctataagagcattatgggcagacagcggcatacagaat
gcctatgaccggcgtcgagaatttcaactgggtgaatctgtaaaatatttcctggataac
ttggataaacttggagaaccagattatattccatcacaacaagatattctgcttgccaga
agacccaccaaaggcatccatgaatatgactttgaaataaaaaatgttcctttcaaaatg
gttgatgtaggtggtcagagatcagaaaggaaacgttggtttgaatgtttcgacagtgtg
acatcaatacttttccttgtttcctcaagtgaatttgaccaggtgcttatggaagatcga
ctgaccaatcgccttacagagtctctgaacatttttgaaacaatcgtcaataaccgggtt
ttcagcaatgtctccataattctgttcttaaacaagacagacttgcttgaggagaaggtg
caaattgtgagcatcaaagactatttcctagaatttgaaggggatccccactgcttaaga
gacgtccaaaaattcctggtggaatgtttccggaacaaacgccgggaccagcagcagaag
cccttataccaccacttcaccactgctatcaacacggagaacatccgcctcgttttccgt
gacgtgaaggatactattctgcatgacaacctcaagcagctcatgctacagtga

DBGET integrated database retrieval system