KEGG   Pongo abelii (Sumatran orangutan): 100173395
Entry
100173395         CDS       T01416                                 

Gene name
CCNG1
Definition
(RefSeq) cyclin-G1
  KO
K10145  cyclin G1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04115  p53 signaling pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100173395 (CCNG1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100173395 (CCNG1)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 100173395
NCBI-ProteinID: NP_001126412
Ensembl: ENSPPYG00000016016
UniProt: Q5R765
LinkDB
Position
5
AA seq 295 aa
MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLL
SLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATD
LIRISQYRFTVSDLMRMEKIVLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFE
RLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQKCVELTEGIECLQKHSKINGRDLTF
WQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPEMVP
NT seq 888 nt   +upstreamnt  +downstreamnt
atgatagaggtactgacaacaactgactctcagaaactgctacaccagctgaacgccctg
ttggaacaggagtctagatgtcagccaaaggtctgtggtttgagactaattgagtctgca
cacgataatggcctcagaatgactgcaagactaagggactttgaagtaaaagatcttctt
agtctaactcagttctttggctttgacacagagacattttctctagctgtgaatttactg
gacagattcctgtctaaaatgaaggtacagcccaagcaccttgggtgtgttggactgagc
tgcttttatttggctgtaaaatcaatagaagaggaaaggaatgtcccattggcaactgac
ttgatccgaataagtcaatataggtttacggtttcagacttgatgagaatggaaaagatt
gtattggagaaggtgtgttggaaagtcaaagctactactgcctttcaatttctgcaactg
tattattcactccttcaagagaacttgccacttgaaaggagaaatagcattaattttgaa
agactagaagctcaactgaaggcatgtcattgcaggatcatattttctaaagcaaagcct
tctgtgttggcattgtctatcattgcattagagatccaagcacagaagtgtgtagagtta
acagaaggaatagaatgtcttcagaaacattccaagataaatggcagagatctgaccttc
tggcaagagcttgtatccaaatgtttaactgaatattcatcaaataagtgttccaaacca
aatgttcagaagttgaaatggattgtttctgggcgtactgcacggcaattgaagcatagc
tactacagaataactcaccttccaacaattcctgaaatggtcccttaa

DBGET integrated database retrieval system