KEGG   Pongo abelii (Sumatran orangutan): 100173447
Entry
100173447         CDS       T01416                                 

Gene name
SLC2A1
Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 1
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04066  HIF-1 signaling pathway
pon04911  Insulin secretion
pon04919  Thyroid hormone signaling pathway
pon04920  Adipocytokine signaling pathway
pon04922  Glucagon signaling pathway
pon04931  Insulin resistance
pon04976  Bile secretion
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05211  Renal cell carcinoma
pon05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100173447 (SLC2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100173447 (SLC2A1)
   04922 Glucagon signaling pathway
    100173447 (SLC2A1)
   04920 Adipocytokine signaling pathway
    100173447 (SLC2A1)
   04919 Thyroid hormone signaling pathway
    100173447 (SLC2A1)
  09154 Digestive system
   04976 Bile secretion
    100173447 (SLC2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100173447 (SLC2A1)
   05230 Central carbon metabolism in cancer
    100173447 (SLC2A1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100173447 (SLC2A1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100173447 (SLC2A1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100173447 (SLC2A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100173447 (SLC2A1)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   100173447 (SLC2A1)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    100173447 (SLC2A1)
SSDB
Motif
Pfam: Sugar_tr MFS_1 TRI12 BT1 DUF523
Other DBs
NCBI-GeneID: 100173447
NCBI-ProteinID: NP_001126460
UniProt: Q5R6Y3
LinkDB
Position
1
AA seq 278 aa
MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGERILPTT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFE
MLILGRFVIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIM
GNEDLWPLLLSIIFVPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHD
LQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVL
NT seq 837 nt   +upstreamnt  +downstreamnt
atggagcccagcagcaagaagctgacgggtcgcctcatgctggccgtgggaggagcagtg
cttggctcccttcagtttggctacaacactggagtcatcaatgccccccagaaggtgatc
gaggagttctacaaccagacatgggtccaccgctatggggagcgcatcctgcccaccacg
ctcaccacgctctggtccctctcggtggccatcttttctgttgggggcatgattggctcc
ttctctgtgggccttttcgttaaccgctttggccggcggaactcaatgctgatgatgaac
ctgctggccttcgtgtccgccgtgctcatgggcttctcgaaactgggcaagtcctttgag
atgctgatcctgggccgcttcgtcatcggtgtgtactgcggcctgaccacaggcttcgtg
cccatgtatgtgggtgaagtgtcacccacagcccttcgtggggccctgggcaccctgcac
cagctgggcattgtcgtcggcatcctcatcgcccaggtgttcggcctggactccatcatg
ggcaacgaggacctgtggcccctgctgctgagcatcatcttcgtcccggccctgctgcag
tgcatcgtgctgcccttctgccccgagagtccccgcttcctgctcatcaaccgcaacgag
gagaaccgggccaagagtgtgctgaagaagctgcgcgggacggctgacgtgacccatgac
ctgcaggagatgaaggaagagagtcggcagatgatgcgggagaagaaggtcaccatcctg
gagctcttccgctcccccgcctaccgccagcccatcctcatcgccgtggtgctgtag

DBGET integrated database retrieval system