KEGG   Pongo abelii (Sumatran orangutan): 100173576
Entry
100173576         CDS       T01416                                 

Gene name
SPRY2
Definition
(RefSeq) protein sprouty homolog 2
  KO
K17383  protein sprouty homolog 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100173576 (SPRY2)
SSDB
Motif
Pfam: Sprouty
Other DBs
NCBI-GeneID: 100173576
NCBI-ProteinID: NP_001126584
UniProt: Q5R959
LinkDB
Position
13
AA seq 315 aa
MEARAQSGNGSQPLLQTPRDGGRPRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPT
VVPRPGLKPAPRPSTQHKHERLHGLPEHRQPPRLQHSQVHSSARAPLSRSISTVSSGSRS
STRTSTSSSSSEQRLLGSSFSSGPVADGIIRVQPKSELKPGELKPLSKEDLGLHAYRCED
CGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTCVCCVKGLFYHCSNDDEDNRADN
PCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVC
CKVPTVPRRNFEKPT
NT seq 948 nt   +upstreamnt  +downstreamnt
atggaggccagagctcagagtggcaacgggtcgcagcccttgctgcaaacgccccgtgac
ggtggcagaccgcgtggggagcccgaccccagagacgccctcacccagcaggtacatgtc
ttgtctctggatcagatcagagccatccgaaacaccaatgagtacacagaggggcctact
gtcgtcccaagacctgggctcaagcctgctcctcgcccctccactcagcacaaacacgag
agactccacggtctgcctgagcaccgccagcctcctaggctccagcactcgcaggtccat
tcttctgcacgagcccctctgtccagatccataagcacggtcagctcagggtcgcggagc
agtacgaggacaagtaccagcagcagctcctctgaacagagactgctaggatcatccttc
tcctccgggcctgttgctgatgggataatccgggtgcaacccaaatctgagctcaagcca
ggtgagcttaagccactgagcaaggaagatttgggcctgcacgcctacaggtgtgaggac
tgtggcaagtgcaaatgtaaggagtgcacctacccaaggcctctgccatcagactggatc
tgcgacaagcagtgcctttgctcggcccagaacgtgattgactatgggacttgtgtatgc
tgtgtgaaaggtctcttctatcactgttctaatgatgatgaggacaaccgtgctgacaac
ccatgttcttgcagccagtctcactgttgtacacgatggtcggccatgggtgtcatgtcc
ctctttttgccttgtttatggtgttaccttccagccaagggttgccttaaattgtgccag
gggtgttatgaccgggttaacaggcctggttgccgctgtaaaaactcaaacacagtttgc
tgcaaagttcccactgtcccccgcaggaactttgaaaaaccaacatag

DBGET integrated database retrieval system