KEGG   Pongo abelii (Sumatran orangutan): 100173589
Entry
100173589         CDS       T01416                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon01524  Platinum drug resistance
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04070  Phosphatidylinositol signaling system
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04210  Apoptosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04218  Cellular senescence
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04620  Toll-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04668  TNF signaling pathway
pon04670  Leukocyte transendothelial migration
pon04722  Neurotrophin signaling pathway
pon04725  Cholinergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04917  Prolactin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04926  Relaxin signaling pathway
pon04929  GnRH secretion
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon04960  Aldosterone-regulated sodium reabsorption
pon04973  Carbohydrate digestion and absorption
pon05010  Alzheimer disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05100  Bacterial invasion of epithelial cells
pon05135  Yersinia infection
pon05142  Chagas disease
pon05146  Amoebiasis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100173589 (PIK3R1)
   04014 Ras signaling pathway
    100173589 (PIK3R1)
   04015 Rap1 signaling pathway
    100173589 (PIK3R1)
   04370 VEGF signaling pathway
    100173589 (PIK3R1)
   04630 JAK-STAT signaling pathway
    100173589 (PIK3R1)
   04668 TNF signaling pathway
    100173589 (PIK3R1)
   04066 HIF-1 signaling pathway
    100173589 (PIK3R1)
   04068 FoxO signaling pathway
    100173589 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    100173589 (PIK3R1)
   04072 Phospholipase D signaling pathway
    100173589 (PIK3R1)
   04071 Sphingolipid signaling pathway
    100173589 (PIK3R1)
   04024 cAMP signaling pathway
    100173589 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    100173589 (PIK3R1)
   04152 AMPK signaling pathway
    100173589 (PIK3R1)
   04150 mTOR signaling pathway
    100173589 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100173589 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    100173589 (PIK3R1)
   04218 Cellular senescence
    100173589 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100173589 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100173589 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100173589 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100173589 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    100173589 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    100173589 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    100173589 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    100173589 (PIK3R1)
   04660 T cell receptor signaling pathway
    100173589 (PIK3R1)
   04662 B cell receptor signaling pathway
    100173589 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    100173589 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    100173589 (PIK3R1)
   04670 Leukocyte transendothelial migration
    100173589 (PIK3R1)
   04062 Chemokine signaling pathway
    100173589 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100173589 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    100173589 (PIK3R1)
   04929 GnRH secretion
    100173589 (PIK3R1)
   04915 Estrogen signaling pathway
    100173589 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    100173589 (PIK3R1)
   04917 Prolactin signaling pathway
    100173589 (PIK3R1)
   04926 Relaxin signaling pathway
    100173589 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    100173589 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    100173589 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100173589 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100173589 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    100173589 (PIK3R1)
   04722 Neurotrophin signaling pathway
    100173589 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100173589 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    100173589 (PIK3R1)
   04380 Osteoclast differentiation
    100173589 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    100173589 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    100173589 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100173589 (PIK3R1)
   05206 MicroRNAs in cancer
    100173589 (PIK3R1)
   05205 Proteoglycans in cancer
    100173589 (PIK3R1)
   05203 Viral carcinogenesis
    100173589 (PIK3R1)
   05230 Central carbon metabolism in cancer
    100173589 (PIK3R1)
   05231 Choline metabolism in cancer
    100173589 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100173589 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100173589 (PIK3R1)
   05212 Pancreatic cancer
    100173589 (PIK3R1)
   05225 Hepatocellular carcinoma
    100173589 (PIK3R1)
   05226 Gastric cancer
    100173589 (PIK3R1)
   05214 Glioma
    100173589 (PIK3R1)
   05221 Acute myeloid leukemia
    100173589 (PIK3R1)
   05220 Chronic myeloid leukemia
    100173589 (PIK3R1)
   05218 Melanoma
    100173589 (PIK3R1)
   05211 Renal cell carcinoma
    100173589 (PIK3R1)
   05215 Prostate cancer
    100173589 (PIK3R1)
   05213 Endometrial cancer
    100173589 (PIK3R1)
   05224 Breast cancer
    100173589 (PIK3R1)
   05222 Small cell lung cancer
    100173589 (PIK3R1)
   05223 Non-small cell lung cancer
    100173589 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100173589 (PIK3R1)
   05017 Spinocerebellar ataxia
    100173589 (PIK3R1)
   05020 Prion disease
    100173589 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100173589 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100173589 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    100173589 (PIK3R1)
   04931 Insulin resistance
    100173589 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100173589 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100173589 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    100173589 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100173589 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    100173589 (PIK3R1)
   05161 Hepatitis B
    100173589 (PIK3R1)
   05160 Hepatitis C
    100173589 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    100173589 (PIK3R1)
   05164 Influenza A
    100173589 (PIK3R1)
   05162 Measles
    100173589 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    100173589 (PIK3R1)
   05163 Human cytomegalovirus infection
    100173589 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100173589 (PIK3R1)
   05169 Epstein-Barr virus infection
    100173589 (PIK3R1)
   05165 Human papillomavirus infection
    100173589 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100173589 (PIK3R1)
   05142 Chagas disease
    100173589 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100173589 (PIK3R1)
   01524 Platinum drug resistance
    100173589 (PIK3R1)
   01522 Endocrine resistance
    100173589 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100173589 (PIK3R1)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100173589 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 SH3_2 Laminin_I Nucleopor_Nup85 Lant_dehydr_C FANCI_S2 PI_PP_I Mod_r Bap31_Bap29_C
Other DBs
NCBI-GeneID: 100173589
NCBI-ProteinID: NP_001126593
Ensembl: ENSPPYG00000015520
UniProt: Q5R685
LinkDB
Position
5
AA seq 724 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAE
QLAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTASVDLEMIDVH
VLADAFKRYLLDLPNPVIPAAVYSEMISLAQEVQSSEEYIQLLKKLIRSPSIPHQYWLTL
QYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIID
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgctgaggggtaccagtacagagcgctgtatgattataaaaaggaaagagaagaa
gatattgacttgcacttgggtgacatattgactgtgaataaagggtccttagtagctctt
ggattcagtgatggacaggaagccaggcctgaagaaattggctggttaaatggctataat
gaaaccacaggggaaaggggggactttccgggaacttatgtagaatatattggaaggaaa
aaaatctcgcctcccacaccaaagccccggccacctcggcctcttcctgttgcaccaggt
tcttcgaaaactgaagcagatgttgaacaacaagctttgactctcccggatcttgcagag
cagttagcccctcctgacattgccccgcctcttcttatcaagctcgtggaagccattgaa
aagaaaggtctggaatgttcaactctatacagaacacagagctccagcaacctggcagaa
ttacgacagcttcttgattgtgatacagcctctgtggacttggaaatgattgatgtgcac
gttttggccgacgctttcaaacgctatctcctggacttaccaaatcctgtcattccagca
gccgtttacagtgaaatgatttctttagctcaagaagtacaaagctccgaagaatatatt
cagctattgaagaagcttattaggtcgcctagcatacctcatcagtattggcttacactt
cagtatttgttaaaacatttcttcaagctctctcaaacctccagcaaaaatctgttgaat
gcaagagtactctctgaaattttcagccctatgcttttcagattctcagcagccagctct
gataatactgaaaacctcataaaagttatagaaattttaatctcaactgaatggaatgaa
cgacagcctgcaccagcactgcctcctaaaccaccaaaacccactactgtagccaacaac
ggtatgaataacaatatgtccttacaagatgctgaatggtactggggagatatctcgagg
gaagaagtgaatgaaaaacttcgagatacagcagacgggacctttttggtacgagatgcg
tctactaaaatgcatggtgattatactcttacactaaggaaagggggtaataacaaatta
atcaaaatatttcatcgagatgggaaatatggcttctctgacccattaaccttcaattct
gtggttgaattaataaaccactaccggaatgaatctctagctcagtataatcccaaattg
gatgtgaaattactttacccagtatccaaataccaacaggatcaagttgtcaaagaagat
aatattgaagctgtagggaaaaaattgcatgaatataacactcagtttcaagaaaaaagt
cgagaatatgatagattatatgaagaatatacccgtacatcccaggaaatccagatgaaa
aggacagctattgaagcatttaatgaaaccataaaaatatttgaagaacagtgccagacc
caagagcggtacagcaaagaatacatagaaaagtttaaacgtgaaggcaatgagaaagaa
atacaaaggattatgcataattatgataagttgaagtctcgaatcagtgaaattattgac
agtagaagaagattggaagaagacttgaagaagcaggcagctgagtatcgagaaattgac
aaacgtatgaacagcattaaacctgaccttatccagctgagaaagacaagagaccaatac
ttgatgtggctgactcaaaaaggtgttcggcaaaagaagttgaacgagtggttgggcaat
gaaaacactgaagaccaatattcactggtggaagatgatgaagatttgccccatcatgat
gagaagacgtggaacgttggaagcagcaaccgaaacaaagctgaaaacctgttgcgaggg
aagcgagatggcacttttcttgtccgggagagcagtaaacagggctgctacgcctgctct
gtagtggtggacggcgaagtaaagcattgtgtcataaacaaaacagcaactggctatggc
tttgccgagccctataacttgtacagctctctgaaagaactggtgctacattaccaacac
acctccctcgtgcagcacaacgactccctcaatgtcacactagcctacccagtatatgca
cagcagaggcgatga

KEGG   Pongo abelii (Sumatran orangutan): 100174298
Entry
100174298         CDS       T01416                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon01524  Platinum drug resistance
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04070  Phosphatidylinositol signaling system
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04210  Apoptosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04218  Cellular senescence
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04620  Toll-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04668  TNF signaling pathway
pon04670  Leukocyte transendothelial migration
pon04722  Neurotrophin signaling pathway
pon04725  Cholinergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04917  Prolactin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04926  Relaxin signaling pathway
pon04929  GnRH secretion
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon04960  Aldosterone-regulated sodium reabsorption
pon04973  Carbohydrate digestion and absorption
pon05010  Alzheimer disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05100  Bacterial invasion of epithelial cells
pon05135  Yersinia infection
pon05142  Chagas disease
pon05146  Amoebiasis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100174298 (PIK3R3)
   04014 Ras signaling pathway
    100174298 (PIK3R3)
   04015 Rap1 signaling pathway
    100174298 (PIK3R3)
   04370 VEGF signaling pathway
    100174298 (PIK3R3)
   04630 JAK-STAT signaling pathway
    100174298 (PIK3R3)
   04668 TNF signaling pathway
    100174298 (PIK3R3)
   04066 HIF-1 signaling pathway
    100174298 (PIK3R3)
   04068 FoxO signaling pathway
    100174298 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    100174298 (PIK3R3)
   04072 Phospholipase D signaling pathway
    100174298 (PIK3R3)
   04071 Sphingolipid signaling pathway
    100174298 (PIK3R3)
   04024 cAMP signaling pathway
    100174298 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    100174298 (PIK3R3)
   04152 AMPK signaling pathway
    100174298 (PIK3R3)
   04150 mTOR signaling pathway
    100174298 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100174298 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    100174298 (PIK3R3)
   04218 Cellular senescence
    100174298 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100174298 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100174298 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100174298 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100174298 (PIK3R3)
   04613 Neutrophil extracellular trap formation
    100174298 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    100174298 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    100174298 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    100174298 (PIK3R3)
   04660 T cell receptor signaling pathway
    100174298 (PIK3R3)
   04662 B cell receptor signaling pathway
    100174298 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    100174298 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    100174298 (PIK3R3)
   04670 Leukocyte transendothelial migration
    100174298 (PIK3R3)
   04062 Chemokine signaling pathway
    100174298 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100174298 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    100174298 (PIK3R3)
   04929 GnRH secretion
    100174298 (PIK3R3)
   04915 Estrogen signaling pathway
    100174298 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    100174298 (PIK3R3)
   04917 Prolactin signaling pathway
    100174298 (PIK3R3)
   04926 Relaxin signaling pathway
    100174298 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    100174298 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    100174298 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100174298 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100174298 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    100174298 (PIK3R3)
   04722 Neurotrophin signaling pathway
    100174298 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100174298 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    100174298 (PIK3R3)
   04380 Osteoclast differentiation
    100174298 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    100174298 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    100174298 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100174298 (PIK3R3)
   05206 MicroRNAs in cancer
    100174298 (PIK3R3)
   05205 Proteoglycans in cancer
    100174298 (PIK3R3)
   05203 Viral carcinogenesis
    100174298 (PIK3R3)
   05230 Central carbon metabolism in cancer
    100174298 (PIK3R3)
   05231 Choline metabolism in cancer
    100174298 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100174298 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100174298 (PIK3R3)
   05212 Pancreatic cancer
    100174298 (PIK3R3)
   05225 Hepatocellular carcinoma
    100174298 (PIK3R3)
   05226 Gastric cancer
    100174298 (PIK3R3)
   05214 Glioma
    100174298 (PIK3R3)
   05221 Acute myeloid leukemia
    100174298 (PIK3R3)
   05220 Chronic myeloid leukemia
    100174298 (PIK3R3)
   05218 Melanoma
    100174298 (PIK3R3)
   05211 Renal cell carcinoma
    100174298 (PIK3R3)
   05215 Prostate cancer
    100174298 (PIK3R3)
   05213 Endometrial cancer
    100174298 (PIK3R3)
   05224 Breast cancer
    100174298 (PIK3R3)
   05222 Small cell lung cancer
    100174298 (PIK3R3)
   05223 Non-small cell lung cancer
    100174298 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100174298 (PIK3R3)
   05017 Spinocerebellar ataxia
    100174298 (PIK3R3)
   05020 Prion disease
    100174298 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100174298 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100174298 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    100174298 (PIK3R3)
   04931 Insulin resistance
    100174298 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100174298 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100174298 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    100174298 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100174298 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    100174298 (PIK3R3)
   05161 Hepatitis B
    100174298 (PIK3R3)
   05160 Hepatitis C
    100174298 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    100174298 (PIK3R3)
   05164 Influenza A
    100174298 (PIK3R3)
   05162 Measles
    100174298 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    100174298 (PIK3R3)
   05163 Human cytomegalovirus infection
    100174298 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100174298 (PIK3R3)
   05169 Epstein-Barr virus infection
    100174298 (PIK3R3)
   05165 Human papillomavirus infection
    100174298 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100174298 (PIK3R3)
   05142 Chagas disease
    100174298 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100174298 (PIK3R3)
   01524 Platinum drug resistance
    100174298 (PIK3R3)
   01522 Endocrine resistance
    100174298 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100174298 (PIK3R3)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100174298 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Borrelia_P83 Transcrip_act DUF5638 Cupin_8 Laminin_I Fez1 Mod_r
Other DBs
NCBI-GeneID: 100174298
NCBI-ProteinID: NP_001127243
Ensembl: ENSPPYG00000001402
UniProt: Q5RDL1
LinkDB
Position
1
AA seq 483 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVPNGMKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDAPTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDLLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMCLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDADENYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCRQRGSGKRGGSLAFFSTVFI
RLR
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagcagttccaaatggaatgaaggacagttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaggtaaatgacaaattgcgg
gatatgccggatgggaccttcttggtccgagatgccccaacaaaaatgcagggagattat
actttgactttgcggaagggaggcaataataagttaataaagatctatcaccgggatggt
aaatatggcttttctgatcctctgacatttaattccgtggtggagctcattaaccactat
caccatgaatctcttgctcagtacaatcccaaacttgatgtgaagctgatgtacccagtg
tccagataccaacaggatctgttggtaaaagaagataatattgatgcagtaggtaaaaaa
ctgcaagaataccactctcagtatcaggagaagagtaaagagtatgataggctgtatgaa
gaatatactagaacatcccaggaaatacagatgaagaggactgcaatcgaagcttttaat
gaaacaattaaaatatttgaagagcagtgtcacacacaagaacaacatagcaaagaatat
attgagcgatttcgcagagaggggaatgaaaaggagattgaacgaattatgatgaattat
gataaattgaaatcacgtctgggcgagattcatgatagcaaaatgtgtctagagcaggat
ttgaagaaacaagctttggacaaccgagaaatagataaaaaaatgaatagtatcaaacct
gacctgatccagctgcgaaagatccgagatcaacaccttgtatggcttaatcacaaagga
gtgagacagaaacgcctgaatgtctggctgggaattaagaatgaggatgctgatgagaac
tattttatcaatgaggaagatgaaaacctgccccattatgatgagaaaacctggtttgtt
gaggatatcaatcgagtacaagcagaggacttgctttatgggaaacctgatggtgcattc
ttaattcgtgagagtagcaagaaaggatgctatgcttgttctgtggtggccgatggggaa
gtgaagcactgtgtgatctacagcactgctcggggctatggctttgcagagccctacaac
ctgtatagctctctgaaggagctagtgctccattaccagcagacatccttggttcagcac
aacgactccctcaacgtcaggcttgcctaccctgttcatgcacagatgccctcgctttgc
agacaaagaggaagtgggaagagaggtggttctctggcatttttttctacagtttttatt
agactacgatga

KEGG   Pongo abelii (Sumatran orangutan): 100432846
Entry
100432846         CDS       T01416                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00562  Inositol phosphate metabolism
pon01100  Metabolic pathways
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon01524  Platinum drug resistance
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04070  Phosphatidylinositol signaling system
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04210  Apoptosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04218  Cellular senescence
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04620  Toll-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04668  TNF signaling pathway
pon04670  Leukocyte transendothelial migration
pon04722  Neurotrophin signaling pathway
pon04725  Cholinergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04917  Prolactin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04926  Relaxin signaling pathway
pon04929  GnRH secretion
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon04960  Aldosterone-regulated sodium reabsorption
pon04973  Carbohydrate digestion and absorption
pon05010  Alzheimer disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
pon05135  Yersinia infection
pon05142  Chagas disease
pon05146  Amoebiasis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100432846 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100432846 (PIK3CB)
   04014 Ras signaling pathway
    100432846 (PIK3CB)
   04015 Rap1 signaling pathway
    100432846 (PIK3CB)
   04370 VEGF signaling pathway
    100432846 (PIK3CB)
   04630 JAK-STAT signaling pathway
    100432846 (PIK3CB)
   04668 TNF signaling pathway
    100432846 (PIK3CB)
   04066 HIF-1 signaling pathway
    100432846 (PIK3CB)
   04068 FoxO signaling pathway
    100432846 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    100432846 (PIK3CB)
   04072 Phospholipase D signaling pathway
    100432846 (PIK3CB)
   04071 Sphingolipid signaling pathway
    100432846 (PIK3CB)
   04024 cAMP signaling pathway
    100432846 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    100432846 (PIK3CB)
   04152 AMPK signaling pathway
    100432846 (PIK3CB)
   04150 mTOR signaling pathway
    100432846 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100432846 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    100432846 (PIK3CB)
   04218 Cellular senescence
    100432846 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100432846 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    100432846 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100432846 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100432846 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    100432846 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    100432846 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    100432846 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    100432846 (PIK3CB)
   04660 T cell receptor signaling pathway
    100432846 (PIK3CB)
   04662 B cell receptor signaling pathway
    100432846 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    100432846 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    100432846 (PIK3CB)
   04670 Leukocyte transendothelial migration
    100432846 (PIK3CB)
   04062 Chemokine signaling pathway
    100432846 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100432846 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    100432846 (PIK3CB)
   04929 GnRH secretion
    100432846 (PIK3CB)
   04915 Estrogen signaling pathway
    100432846 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    100432846 (PIK3CB)
   04917 Prolactin signaling pathway
    100432846 (PIK3CB)
   04926 Relaxin signaling pathway
    100432846 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    100432846 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    100432846 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100432846 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100432846 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    100432846 (PIK3CB)
   04722 Neurotrophin signaling pathway
    100432846 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100432846 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    100432846 (PIK3CB)
   04380 Osteoclast differentiation
    100432846 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    100432846 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    100432846 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100432846 (PIK3CB)
   05206 MicroRNAs in cancer
    100432846 (PIK3CB)
   05205 Proteoglycans in cancer
    100432846 (PIK3CB)
   05203 Viral carcinogenesis
    100432846 (PIK3CB)
   05230 Central carbon metabolism in cancer
    100432846 (PIK3CB)
   05231 Choline metabolism in cancer
    100432846 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100432846 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100432846 (PIK3CB)
   05212 Pancreatic cancer
    100432846 (PIK3CB)
   05225 Hepatocellular carcinoma
    100432846 (PIK3CB)
   05226 Gastric cancer
    100432846 (PIK3CB)
   05214 Glioma
    100432846 (PIK3CB)
   05221 Acute myeloid leukemia
    100432846 (PIK3CB)
   05220 Chronic myeloid leukemia
    100432846 (PIK3CB)
   05218 Melanoma
    100432846 (PIK3CB)
   05211 Renal cell carcinoma
    100432846 (PIK3CB)
   05215 Prostate cancer
    100432846 (PIK3CB)
   05213 Endometrial cancer
    100432846 (PIK3CB)
   05224 Breast cancer
    100432846 (PIK3CB)
   05222 Small cell lung cancer
    100432846 (PIK3CB)
   05223 Non-small cell lung cancer
    100432846 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100432846 (PIK3CB)
   05017 Spinocerebellar ataxia
    100432846 (PIK3CB)
   05020 Prion disease
    100432846 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100432846 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100432846 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    100432846 (PIK3CB)
   04931 Insulin resistance
    100432846 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100432846 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100432846 (PIK3CB)
   05135 Yersinia infection
    100432846 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    100432846 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100432846 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    100432846 (PIK3CB)
   05161 Hepatitis B
    100432846 (PIK3CB)
   05160 Hepatitis C
    100432846 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    100432846 (PIK3CB)
   05164 Influenza A
    100432846 (PIK3CB)
   05162 Measles
    100432846 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    100432846 (PIK3CB)
   05163 Human cytomegalovirus infection
    100432846 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100432846 (PIK3CB)
   05169 Epstein-Barr virus infection
    100432846 (PIK3CB)
   05165 Human papillomavirus infection
    100432846 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100432846 (PIK3CB)
   05142 Chagas disease
    100432846 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100432846 (PIK3CB)
   01524 Platinum drug resistance
    100432846 (PIK3CB)
   01522 Endocrine resistance
    100432846 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100432846 (PIK3CB)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100432846 (PIK3CB)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100432846 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C
Other DBs
NCBI-GeneID: 100432846
NCBI-ProteinID: XP_002814141
Ensembl: ENSPPYG00000014147
UniProt: A0A6D2YAW0 A0A2J8TTN5
LinkDB
Position
3
AA seq 1070 aa
MCFSFIMPPAMADILDIWAVDSQIASDGSILVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDSLKDPEVNEFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEH
EPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEVSGKNDHIWNEPLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHVKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKE
ILDRDPLSQLCENEMDLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLQQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALGNRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAVKLNRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttcagtttcataatgcctcctgctatggcagacatccttgacatctgggcggtg
gattcacagatagcatctgatggctccatacttgtggatttccttttgcccactgggatt
tacatccagttggaggtacctcgggaagctaccatttcttatattaagcagatgttatgg
aagcaagttcacaattacccaatgttcaacctccttatggatattgactcctatatgttt
gcatgtgtgaatcagactgctgtatatgaggagcttgaagatgaaacacgaagactctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattggactcaaaaattggagtccttataggaaaaggtctgcatgaatttgattccttg
aaggatcctgaagtaaatgaatttcgaagaaaaatgcgcaaattcagcgaggaaaaaatc
ctgtcacttgtgggattgtcttggatggactggctaaaacaaacatatccaccagagcat
gaaccatccatccctgaaaacttagaagataaactttatgggggaaagctcattgtagct
gttcattttgaaaactgccaggacgtgtttagctttcaagtgtctcctaatatgaatcct
atcaaagtaaatgaattggcaatccaaaaacgtttgactattcatgggaaggaagatgaa
gttagcccctatgattatgtgttgcaagtcagcgggagagtagaatatgtttttggtgat
catccactaattcagttccagtatatccggaactgtgtgatgaacaggaccctgccccat
tttatacttgtggaatgctgcaagatcaagaaaatgtatgaacaggaaatgattgccata
gaggctgccataaatcgaaattcatctaatcttcctcttccgttaccaccaaagaaaaca
cgaattatttctcatgtttgggaaaataacaaccctttccaaattgtcttggttaaggga
aataaacttaacacagaggaaactgtaaaagttcatgtcagggctggtctttttcatggt
actgagctcctgtgtaaaaccatcgtaagctcagaggtatcagggaaaaatgatcatatt
tggaatgaaccactggaatttgatattaatatttgtgacttaccaagaatggctcgatta
tgttttgctgtttatgcagttttggataaagtaaaaacgaagaaatcaacgaaaactatt
aatccctcaaaatatcagaccatcaggaaagctggaaaagtgcattatcctgtagcgtgg
gtaaatacgatggtttttgactttaaaggacaattgagaactggagacataatattacac
agctggtcttcatttcctgatgaactcgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatactgaaaatgcaacagctttgcatgttaaatttccagagaataaaaaa
caaccttattattaccctcccttcgataagattattgaaaaggcagctgagattgcaagc
agtgatagtgctaatgtgtcaagtcgaggtggaaaaaagtttcttcctgtattgaaagaa
atcttggacagggatcccttgtctcaactgtgtgaaaatgaaatggatcttatttggact
ttgcgacaagactgccgagagattttcccacaatcactgccaaaattactgctgtcaatc
aagtggaataaacttgaggatgttgctcagcttcaggcgctgcttcagatttggcctaaa
ctgcccccccgggaggccctagagcttctggatttcaactatccagaccagtacgttcga
gaatatgctgtaggctgcctgcaacagatgagtgatgaagaactttctcaatatctttta
caactggtgcaagtgttaaaatatgagccttttcttgattgtgccctctctagattccta
ttagaaagagcacttggtaatcggaggatagggcagtttctattttggcatcttaggtca
gaagtgcacattcctgctgtctcagtacaatttggtgtcatccttgaagcatactgccgg
ggaagtgtggggcacatgaaagtgctttctaagcaggttgaagcactcaataagttaaaa
actttgaatagtttaatcaaactgaatgccgtgaagttaaacagagccaaagggaaggag
gccatgcatacctgtttaaaacagagtgcttaccgggaagccctctctgacctgcagtca
cccctgaacccatgtgttatcctctcagaactctatgttgaaaagtgcaaatacatggat
tccaaaatgaagcctttgtggctggtatacaataacaaggtatttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacgacaggatatgttgacactccaaatgttg
cgcctgatggatttactctggaaagaagctggtttggatcttcggatgttgccttatggc
tgtttagcaacaggagatcgctctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgctgcagcagccttcaacaaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctggaccgagccattgaggaa
tttacactgtcctgtgctggctactgtgtagcttcttatgtccttggcattggtgacaga
catagtgacaacatcatggtcaaaaaaactggccagctcttccacattgactttggacac
attcttggaaatttcaaatctaagtttggcattaaaagggagcgagtgccttttattctt
acctatgatttcatccatgtcattcaacaaggaaaaacaggaaatacagaaaagtttggc
cggttccgccagtgttgtgaagatgcatatctgattttacgacggcatgggaatctcttc
atcactctctttgcgctgatgttgactgcagggcttcctgaactcacatcagtcaaagat
atacagtatcttaaggactctcttgcattagggaagagtgaagaagaagcactcaaacag
tttaagcaaaaatttgatgaggcgctcagggaaagctggactactaaagtgaactggatg
gcccacacagttcggaaagactacagatcttaa

KEGG   Pongo abelii (Sumatran orangutan): 100437617
Entry
100437617         CDS       T01416                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon01524  Platinum drug resistance
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04070  Phosphatidylinositol signaling system
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04210  Apoptosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04218  Cellular senescence
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04620  Toll-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04668  TNF signaling pathway
pon04670  Leukocyte transendothelial migration
pon04722  Neurotrophin signaling pathway
pon04725  Cholinergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04917  Prolactin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04926  Relaxin signaling pathway
pon04929  GnRH secretion
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon04960  Aldosterone-regulated sodium reabsorption
pon04973  Carbohydrate digestion and absorption
pon05010  Alzheimer disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05100  Bacterial invasion of epithelial cells
pon05135  Yersinia infection
pon05142  Chagas disease
pon05146  Amoebiasis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100437617 (PIK3R2)
   04014 Ras signaling pathway
    100437617 (PIK3R2)
   04015 Rap1 signaling pathway
    100437617 (PIK3R2)
   04370 VEGF signaling pathway
    100437617 (PIK3R2)
   04630 JAK-STAT signaling pathway
    100437617 (PIK3R2)
   04668 TNF signaling pathway
    100437617 (PIK3R2)
   04066 HIF-1 signaling pathway
    100437617 (PIK3R2)
   04068 FoxO signaling pathway
    100437617 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    100437617 (PIK3R2)
   04072 Phospholipase D signaling pathway
    100437617 (PIK3R2)
   04071 Sphingolipid signaling pathway
    100437617 (PIK3R2)
   04024 cAMP signaling pathway
    100437617 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    100437617 (PIK3R2)
   04152 AMPK signaling pathway
    100437617 (PIK3R2)
   04150 mTOR signaling pathway
    100437617 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100437617 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    100437617 (PIK3R2)
   04218 Cellular senescence
    100437617 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100437617 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100437617 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100437617 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100437617 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    100437617 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    100437617 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    100437617 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    100437617 (PIK3R2)
   04660 T cell receptor signaling pathway
    100437617 (PIK3R2)
   04662 B cell receptor signaling pathway
    100437617 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    100437617 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    100437617 (PIK3R2)
   04670 Leukocyte transendothelial migration
    100437617 (PIK3R2)
   04062 Chemokine signaling pathway
    100437617 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100437617 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    100437617 (PIK3R2)
   04929 GnRH secretion
    100437617 (PIK3R2)
   04915 Estrogen signaling pathway
    100437617 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    100437617 (PIK3R2)
   04917 Prolactin signaling pathway
    100437617 (PIK3R2)
   04926 Relaxin signaling pathway
    100437617 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    100437617 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    100437617 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100437617 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100437617 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    100437617 (PIK3R2)
   04722 Neurotrophin signaling pathway
    100437617 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100437617 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    100437617 (PIK3R2)
   04380 Osteoclast differentiation
    100437617 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    100437617 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    100437617 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100437617 (PIK3R2)
   05206 MicroRNAs in cancer
    100437617 (PIK3R2)
   05205 Proteoglycans in cancer
    100437617 (PIK3R2)
   05203 Viral carcinogenesis
    100437617 (PIK3R2)
   05230 Central carbon metabolism in cancer
    100437617 (PIK3R2)
   05231 Choline metabolism in cancer
    100437617 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100437617 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100437617 (PIK3R2)
   05212 Pancreatic cancer
    100437617 (PIK3R2)
   05225 Hepatocellular carcinoma
    100437617 (PIK3R2)
   05226 Gastric cancer
    100437617 (PIK3R2)
   05214 Glioma
    100437617 (PIK3R2)
   05221 Acute myeloid leukemia
    100437617 (PIK3R2)
   05220 Chronic myeloid leukemia
    100437617 (PIK3R2)
   05218 Melanoma
    100437617 (PIK3R2)
   05211 Renal cell carcinoma
    100437617 (PIK3R2)
   05215 Prostate cancer
    100437617 (PIK3R2)
   05213 Endometrial cancer
    100437617 (PIK3R2)
   05224 Breast cancer
    100437617 (PIK3R2)
   05222 Small cell lung cancer
    100437617 (PIK3R2)
   05223 Non-small cell lung cancer
    100437617 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100437617 (PIK3R2)
   05017 Spinocerebellar ataxia
    100437617 (PIK3R2)
   05020 Prion disease
    100437617 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100437617 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100437617 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    100437617 (PIK3R2)
   04931 Insulin resistance
    100437617 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100437617 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100437617 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    100437617 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100437617 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    100437617 (PIK3R2)
   05161 Hepatitis B
    100437617 (PIK3R2)
   05160 Hepatitis C
    100437617 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    100437617 (PIK3R2)
   05164 Influenza A
    100437617 (PIK3R2)
   05162 Measles
    100437617 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    100437617 (PIK3R2)
   05163 Human cytomegalovirus infection
    100437617 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100437617 (PIK3R2)
   05169 Epstein-Barr virus infection
    100437617 (PIK3R2)
   05165 Human papillomavirus infection
    100437617 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100437617 (PIK3R2)
   05142 Chagas disease
    100437617 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100437617 (PIK3R2)
   01524 Platinum drug resistance
    100437617 (PIK3R2)
   01522 Endocrine resistance
    100437617 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100437617 (PIK3R2)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100437617 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 Ribosomal_L22e Tai4 ATG11
Other DBs
NCBI-GeneID: 100437617
NCBI-ProteinID: XP_024094201
Ensembl: ENSPPYG00000009731
LinkDB
Position
19
AA seq 727 aa
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGAPEPGLTLPDLPEQFSP
PDVAPPLLVKLVEAIERTGLDSESHYRPELPAPRTDWSLSDVDQWDAAALADGIKSFLLA
LPAPLVTPEASAEARRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLGRVARRAPALG
PAVRALGATFGPLLLRAPPPSSPPPGGAPDGSEPSPDFPALLVEKLLQEHLEEQEVAPPA
LPPKPPKAKPAPTGLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKI
QGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLINHYRHESLAQYNAKLDTRL
LYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAI
EAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTK
LEQQLRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNET
EDQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVV
DGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGP
GPPPAAR
NT seq 2184 nt   +upstreamnt  +downstreamnt
atggcgggccctgagggcttccagtaccgcgctctgtacccgttccgccgggagcggccg
gaggacctggagctgctgcccggcgacgtgctggtagtgagccgggcggccttgcaggca
ctgggcgtggccgagggtggcgagcgctgcccacagagcgtgggctggatgcccggcctc
aatgagcgcacacggcagcgaggtgacttccctggcacctacgtggagttcctagggccc
gtggccctggcccggcccggccctcgcccacggggcccccgcccactgcccgccaggccc
cgtgatggggcccctgagccaggcctcacactccccgacttgcctgagcagttctcccca
cctgatgtggctccccctcttctggtgaagcttgtggaggccattgaaaggacagggctg
gacagcgaatctcactaccgcccggagctgcccgcaccgcgtacagactggtccctgagc
gacgtggatcagtgggacgcggcagccctggctgacggcattaagagcttcctgctggca
ctgcccgcgccgctcgtgacccccgaggcctcggccgaggcgcgccgggccctgcgggag
gccgcgggacccgtggggccggcgctggagccaccgacgctgccgctgcaccgcgcgctc
acgctgcgcttcctgctccagcacctgggccgcgtggcccgccgcgccccggccctgggt
cccgcggtccgggccctgggcgccacctttgggccgctgctgctgcgcgcgccgccgccg
tcctcgccgccgccagggggcgctcccgacgggagtgagcccagccctgacttcccggcg
ctgctggtggagaagctgcttcaggagcacttggaagagcaggaggttgcacccccagcg
ctgccgcctaaaccccccaaggcaaagccggcccctacaggcctggccaatggagggagc
ccaccctccctgcaggatgctgagtggtactggggggacatttcaagggaggaggtgaac
gagaaactccgggacactcctgatggcaccttcctagtccgagatgcttctagcaagatc
cagggcgagtacacgctgaccctcaggaaaggcgggaacaataagctgatcaaggtcttc
caccgagatgggcactatggcttctcagagccactcaccttctgctccgttgtggacctc
atcaatcactaccgccacgagtcgctggcccagtacaacgccaagctggacacacggctc
ctctaccctgtgtccaaataccagcaggaccagattgtcaaggaggacagcgtggaggcg
gtgggcgcccagcttaaggtctatcaccagcagtaccaggacaagagccgcgagtatgac
cagctctatgaagagtacacacgaacctcccaggagctgcagatgaagcgtaccgcaatt
gaggccttcaatgagactatcaagatcttcgaagagcagggccagactcaagagaagtgc
agcaaggaatacctggagcgcttccggcgtgagggcaacgagaaagagatgcagaggatc
ctgctgaactccgagcggctcaagtcccgcattgccgagatccacgagagccgcacgaag
ctggagcagcagctgcgggcccaggcctcggacaaccgggagatcgacaagcgcatgaac
agcctcaagccggacctcatgcagctgcgcaagatccgagaccagtacctcgtgtggctc
acccagaaaggcgcccggcagaagaaaatcaacgagtggctggggattaaaaatgagact
gaggaccagtacgcactgatggaggacgaggacgatctcccgcaccacgaggaacgcact
tggtacgtgggcaagatcaaccgcacgcaggcagaggagatgctgagcggcaagcgggat
ggcaccttcctcatccgcgagagcagccagcggggctgctacgcctgctccgtggtagtg
gacggcgacaccaagcactgcgtcatctaccgcacggccaccggcttcggcttcgcggag
ccctacaacctgtatgggtcgctgaaggagctggtgctgcactaccagcacgcctcgctc
gtgcagcacaacgacgcactcaccgtcaccctggcgcacccagtgcgcgccccgggcccc
ggcccgccgcctgccgcccgctga

KEGG   Pongo abelii (Sumatran orangutan): 100453779
Entry
100453779         CDS       T01416                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00562  Inositol phosphate metabolism
pon01100  Metabolic pathways
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon01524  Platinum drug resistance
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04070  Phosphatidylinositol signaling system
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04210  Apoptosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04218  Cellular senescence
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04620  Toll-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04668  TNF signaling pathway
pon04670  Leukocyte transendothelial migration
pon04722  Neurotrophin signaling pathway
pon04725  Cholinergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04917  Prolactin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04926  Relaxin signaling pathway
pon04929  GnRH secretion
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon04960  Aldosterone-regulated sodium reabsorption
pon04973  Carbohydrate digestion and absorption
pon05010  Alzheimer disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
pon05135  Yersinia infection
pon05142  Chagas disease
pon05146  Amoebiasis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100453779 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100453779 (PIK3CA)
   04014 Ras signaling pathway
    100453779 (PIK3CA)
   04015 Rap1 signaling pathway
    100453779 (PIK3CA)
   04370 VEGF signaling pathway
    100453779 (PIK3CA)
   04630 JAK-STAT signaling pathway
    100453779 (PIK3CA)
   04668 TNF signaling pathway
    100453779 (PIK3CA)
   04066 HIF-1 signaling pathway
    100453779 (PIK3CA)
   04068 FoxO signaling pathway
    100453779 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    100453779 (PIK3CA)
   04072 Phospholipase D signaling pathway
    100453779 (PIK3CA)
   04071 Sphingolipid signaling pathway
    100453779 (PIK3CA)
   04024 cAMP signaling pathway
    100453779 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    100453779 (PIK3CA)
   04152 AMPK signaling pathway
    100453779 (PIK3CA)
   04150 mTOR signaling pathway
    100453779 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100453779 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    100453779 (PIK3CA)
   04218 Cellular senescence
    100453779 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100453779 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    100453779 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100453779 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100453779 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    100453779 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    100453779 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    100453779 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    100453779 (PIK3CA)
   04660 T cell receptor signaling pathway
    100453779 (PIK3CA)
   04662 B cell receptor signaling pathway
    100453779 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    100453779 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    100453779 (PIK3CA)
   04670 Leukocyte transendothelial migration
    100453779 (PIK3CA)
   04062 Chemokine signaling pathway
    100453779 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100453779 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    100453779 (PIK3CA)
   04929 GnRH secretion
    100453779 (PIK3CA)
   04915 Estrogen signaling pathway
    100453779 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    100453779 (PIK3CA)
   04917 Prolactin signaling pathway
    100453779 (PIK3CA)
   04926 Relaxin signaling pathway
    100453779 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    100453779 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    100453779 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100453779 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100453779 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    100453779 (PIK3CA)
   04722 Neurotrophin signaling pathway
    100453779 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100453779 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    100453779 (PIK3CA)
   04380 Osteoclast differentiation
    100453779 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    100453779 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    100453779 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100453779 (PIK3CA)
   05206 MicroRNAs in cancer
    100453779 (PIK3CA)
   05205 Proteoglycans in cancer
    100453779 (PIK3CA)
   05203 Viral carcinogenesis
    100453779 (PIK3CA)
   05230 Central carbon metabolism in cancer
    100453779 (PIK3CA)
   05231 Choline metabolism in cancer
    100453779 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100453779 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100453779 (PIK3CA)
   05212 Pancreatic cancer
    100453779 (PIK3CA)
   05225 Hepatocellular carcinoma
    100453779 (PIK3CA)
   05226 Gastric cancer
    100453779 (PIK3CA)
   05214 Glioma
    100453779 (PIK3CA)
   05221 Acute myeloid leukemia
    100453779 (PIK3CA)
   05220 Chronic myeloid leukemia
    100453779 (PIK3CA)
   05218 Melanoma
    100453779 (PIK3CA)
   05211 Renal cell carcinoma
    100453779 (PIK3CA)
   05215 Prostate cancer
    100453779 (PIK3CA)
   05213 Endometrial cancer
    100453779 (PIK3CA)
   05224 Breast cancer
    100453779 (PIK3CA)
   05222 Small cell lung cancer
    100453779 (PIK3CA)
   05223 Non-small cell lung cancer
    100453779 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100453779 (PIK3CA)
   05017 Spinocerebellar ataxia
    100453779 (PIK3CA)
   05020 Prion disease
    100453779 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100453779 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100453779 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    100453779 (PIK3CA)
   04931 Insulin resistance
    100453779 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100453779 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100453779 (PIK3CA)
   05135 Yersinia infection
    100453779 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    100453779 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100453779 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    100453779 (PIK3CA)
   05161 Hepatitis B
    100453779 (PIK3CA)
   05160 Hepatitis C
    100453779 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    100453779 (PIK3CA)
   05164 Influenza A
    100453779 (PIK3CA)
   05162 Measles
    100453779 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    100453779 (PIK3CA)
   05163 Human cytomegalovirus infection
    100453779 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100453779 (PIK3CA)
   05169 Epstein-Barr virus infection
    100453779 (PIK3CA)
   05165 Human papillomavirus infection
    100453779 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100453779 (PIK3CA)
   05142 Chagas disease
    100453779 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100453779 (PIK3CA)
   01524 Platinum drug resistance
    100453779 (PIK3CA)
   01522 Endocrine resistance
    100453779 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100453779 (PIK3CA)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100453779 (PIK3CA)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100453779 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 100453779
NCBI-ProteinID: XP_024100632
Ensembl: ENSPPYG00000025901
LinkDB
Position
3
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDMYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccacgaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgactttagaatgcctccgtgaggct
acattaataaccataaagcatgaactatttaaagaagcaagaaaataccccctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttactcaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
atcggcatgccagtgtgtgaatttgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttagggacctcaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaattgccaaagcac
atatataataaattagataaagggcaaataatagtggtgatctgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtaccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcctctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgttgatggctaaagaaagcctttattctcaactgccaatggac
tgttttacaatgccatcttattccagacgcatttccacagctacaccatatatgaatgga
gaaacatctacaaaatctctttgggttataaatagtgcactcagaataaaaattctttgt
gcaacctacgtgaatgtaaatattcgagacattgataagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgacaatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctgaattatgatatgtacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgctctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcatggggaaatataaacttgtttgattacacagacactctagtttctggaaaa
atggccttgaatctttggccagtacctcatggattagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgcttagagttggagtttgactggttc
agcagtgtggtaaagttcccagatatgtcagtgattgaagagcatgccaattggtctgta
tcccgagaagcaggatttagctattcccacgcaggactgagtaacagactagctagagac
aatgaattaagggaaaatgacaaagaacagctcaaagcaatttctacacgagatcctctc
tctgaaatcactgagcaggagaaagattttctatggagccacagacactattgtgtaact
atccccgaaattctacccaaattgcttctgtctgttaaatggaattctagagatgaagta
gcccagatgtattgcttggtaaaagattggcctccaatcaaacctgaacaggctatggaa
cttctggactgtaattacccagatcctatggttcgaggttttgctgttcggtgcttggaa
aaatatttaacagatgacaaactttctcagtatttaattcagctagtacaggtcctaaaa
tatgaacaatatttggataacttgcttgtgagatttttacttaagaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agccagaggtttggcttgcttttggagtcctattgtcgtgcatgtgggatgtatttgaag
cacctgaataggcaagtcgaggcaatggaaaagctcattaacttaactgacattctcaaa
caggagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcaaatgagg
cgaccagatttcatggatgctctacagggctttctgtctcctctaaaccctgctcatcaa
ctaggaaacctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactgtttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcaaattattcgtattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtca
atcggtgactgtgtgggacttattgaggtggtgcgaaattctcacactattatgcaaatt
cagtgcaaaggcggcttgaaaggtgcactgcagttcaacagccacacactacatcagtgg
ctcaaagacaagaacaaaggagaaatatatgatgcagccattgacctgtttacacgttca
tgtgctggatattgtgtagctaccttcattttgggaattggagatcgtcacaatagtaac
atcatggtgaaagacgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgagaacgtgtgccatttgttttgacacaggatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcgacagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgacattgca
tacattcgaaagaccctagccttagataaaactgagcaagaggctttggagtatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaaacagcatgcattgaactga

KEGG   Pongo abelii (Sumatran orangutan): 103889133
Entry
103889133         CDS       T01416                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00562  Inositol phosphate metabolism
pon01100  Metabolic pathways
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon01524  Platinum drug resistance
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04070  Phosphatidylinositol signaling system
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04210  Apoptosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04218  Cellular senescence
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04620  Toll-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04668  TNF signaling pathway
pon04670  Leukocyte transendothelial migration
pon04722  Neurotrophin signaling pathway
pon04725  Cholinergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04917  Prolactin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04926  Relaxin signaling pathway
pon04929  GnRH secretion
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon04960  Aldosterone-regulated sodium reabsorption
pon04973  Carbohydrate digestion and absorption
pon05010  Alzheimer disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
pon05135  Yersinia infection
pon05142  Chagas disease
pon05146  Amoebiasis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103889133 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103889133 (PIK3CD)
   04014 Ras signaling pathway
    103889133 (PIK3CD)
   04015 Rap1 signaling pathway
    103889133 (PIK3CD)
   04370 VEGF signaling pathway
    103889133 (PIK3CD)
   04630 JAK-STAT signaling pathway
    103889133 (PIK3CD)
   04668 TNF signaling pathway
    103889133 (PIK3CD)
   04066 HIF-1 signaling pathway
    103889133 (PIK3CD)
   04068 FoxO signaling pathway
    103889133 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    103889133 (PIK3CD)
   04072 Phospholipase D signaling pathway
    103889133 (PIK3CD)
   04071 Sphingolipid signaling pathway
    103889133 (PIK3CD)
   04024 cAMP signaling pathway
    103889133 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    103889133 (PIK3CD)
   04152 AMPK signaling pathway
    103889133 (PIK3CD)
   04150 mTOR signaling pathway
    103889133 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103889133 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    103889133 (PIK3CD)
   04218 Cellular senescence
    103889133 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103889133 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    103889133 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103889133 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103889133 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    103889133 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    103889133 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    103889133 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    103889133 (PIK3CD)
   04660 T cell receptor signaling pathway
    103889133 (PIK3CD)
   04662 B cell receptor signaling pathway
    103889133 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    103889133 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    103889133 (PIK3CD)
   04670 Leukocyte transendothelial migration
    103889133 (PIK3CD)
   04062 Chemokine signaling pathway
    103889133 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103889133 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    103889133 (PIK3CD)
   04929 GnRH secretion
    103889133 (PIK3CD)
   04915 Estrogen signaling pathway
    103889133 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    103889133 (PIK3CD)
   04917 Prolactin signaling pathway
    103889133 (PIK3CD)
   04926 Relaxin signaling pathway
    103889133 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    103889133 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    103889133 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103889133 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103889133 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    103889133 (PIK3CD)
   04722 Neurotrophin signaling pathway
    103889133 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103889133 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    103889133 (PIK3CD)
   04380 Osteoclast differentiation
    103889133 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    103889133 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    103889133 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103889133 (PIK3CD)
   05206 MicroRNAs in cancer
    103889133 (PIK3CD)
   05205 Proteoglycans in cancer
    103889133 (PIK3CD)
   05203 Viral carcinogenesis
    103889133 (PIK3CD)
   05230 Central carbon metabolism in cancer
    103889133 (PIK3CD)
   05231 Choline metabolism in cancer
    103889133 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103889133 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103889133 (PIK3CD)
   05212 Pancreatic cancer
    103889133 (PIK3CD)
   05225 Hepatocellular carcinoma
    103889133 (PIK3CD)
   05226 Gastric cancer
    103889133 (PIK3CD)
   05214 Glioma
    103889133 (PIK3CD)
   05221 Acute myeloid leukemia
    103889133 (PIK3CD)
   05220 Chronic myeloid leukemia
    103889133 (PIK3CD)
   05218 Melanoma
    103889133 (PIK3CD)
   05211 Renal cell carcinoma
    103889133 (PIK3CD)
   05215 Prostate cancer
    103889133 (PIK3CD)
   05213 Endometrial cancer
    103889133 (PIK3CD)
   05224 Breast cancer
    103889133 (PIK3CD)
   05222 Small cell lung cancer
    103889133 (PIK3CD)
   05223 Non-small cell lung cancer
    103889133 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103889133 (PIK3CD)
   05017 Spinocerebellar ataxia
    103889133 (PIK3CD)
   05020 Prion disease
    103889133 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103889133 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103889133 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    103889133 (PIK3CD)
   04931 Insulin resistance
    103889133 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103889133 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103889133 (PIK3CD)
   05135 Yersinia infection
    103889133 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    103889133 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103889133 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    103889133 (PIK3CD)
   05161 Hepatitis B
    103889133 (PIK3CD)
   05160 Hepatitis C
    103889133 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    103889133 (PIK3CD)
   05164 Influenza A
    103889133 (PIK3CD)
   05162 Measles
    103889133 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    103889133 (PIK3CD)
   05163 Human cytomegalovirus infection
    103889133 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103889133 (PIK3CD)
   05169 Epstein-Barr virus infection
    103889133 (PIK3CD)
   05165 Human papillomavirus infection
    103889133 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103889133 (PIK3CD)
   05142 Chagas disease
    103889133 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103889133 (PIK3CD)
   01524 Platinum drug resistance
    103889133 (PIK3CD)
   01522 Endocrine resistance
    103889133 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    103889133 (PIK3CD)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     103889133 (PIK3CD)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103889133 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2
Other DBs
NCBI-GeneID: 103889133
NCBI-ProteinID: XP_024109054
Ensembl: ENSPPYG00000001909
LinkDB
Position
1
AA seq 1044 aa
MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFH
MLSGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLCDPEVNDFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARTWGP
GTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
AKPPPIPAKKPSSVSLWSLEQPFCIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNMDSAAALLICLPEVAP
HPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQE
HFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMR
QEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSGGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccctggggtggactgccccatggaattctggaccaaggaggagaatcagagcgtc
gtggttgacttcctgctgcccacaggggtctacctgaacttccctgtgtcccgcaatgcc
aacctcagcaccatcaagcagctgctgtggcaccgtgcccagtatgagccgctcttccac
atgctcagtggccccgaggcctatgtgttcacctgcatcaaccagacagcggagcagcag
gagctggaggacgagcaacggcgtctgtgtgacgtgcagcccttcctgcccgtcctgcgc
ctggtggcccgcgagggcgaccgcgtgaagaagctcatcaactcacagatcagcctcctc
atcggcaaaggcctccacgagtttgactccttgtgcgacccagaagtgaatgactttcgc
gccaagatgtgccaattctgcgaggaggcggccgcccgccggcagcagctgggctgggag
gcctggctgcagtacagtttccccctgcagctggagccgtcggctcgaacctgggggcct
ggcaccctgcggctcccaaaccgggcccttctggtcaacgttaagtttgagggcagcgag
gagagcttcaccttccaggtgtccaccaaggacgtgccgctggcgctgatggcctgtgcc
ctgcggaagaaggccacggtgttccggcagccgctggtggagcagccggaagactacacg
ctgcaggtgaacggcaggcatgagtacctgtacggcagctacccgctctgccagttccag
tacatctgcagctgcctgcacagtgggctgacccctcacctgaccatggtccattcctcc
tccatcctcgccatgcgggatgagcagagcaaccctgccccccaggtccagaaaccgcgt
gccaaaccacctcccattcctgcgaagaagccttcctctgtgtccctgtggtccctggag
cagccgttctgcatcgagctcatccagggcagcaaagtgaacgccgacgagcggatgaag
ctggtggtgcaggccgggcttttccacggcaatgagatgctgtgcaagacggtgtccagc
tcggaggtgagcgtgtgctcggagcccgtgtggaagcagcggctggagttcgacatcaac
atctgcgacctgccccgcatggcccgtctctgctttgcactgtacgctgtgatcgagaaa
gccaagaaggctcgctccaccaagaagaagtccaagaaggcggactgccccattgcctgg
gccaacctcatgctgtttgactacaaggaccagcttaagacaggagaacgctgcctctac
atgtggccctccgtcccagatgagaagggtgagctgctgaaccccacgggcactgtgcgc
agtaaccccaacatggatagcgccgccgccctgctcatctgcctgcccgaggtggccccg
caccctgtgtactatcccgccctggagaagatcttggagctggggcggcacagcgagtgt
gtgcatgtcactgaggaggagcagttgcagctgcgggaaatcctggagcggcgggggtct
ggggagctgtacgagcacgagaaggacctggtgtggaagctgcggcatgaagtccaggag
cacttcccggaggcgctagcccggctgctgctggtcaccaagtggaacaagcatgaggat
gtggcccagatgctctacctgctgtgctcctggccggagctgcccgtcctgagcgccctg
gagctgctagacttcagcttccccgattgccacgtaggctccttcgccatcaagtcgctg
cggaaactgacggacgatgagctgttccagtacctgctgcagctggtgcaggtgctcaag
tacgagtcctacctggactgcgagctgaccaaattcctgctggaccgggccctggccaac
cgcaagatcggccacttccttttctggcacctccgctccgagatgcacgtgccatcagtg
gccctgcgctttggcctcatcctggaggcgtactgcaggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagcactgagcaaattgaaggccctgaacgacttcgtcaag
ctaagctctcagaagacccccaagccccagaccaaggagctgatgcacttgtgcatgcgg
caggaggcctacctagaggccctctcccacctgcagtccccactcgaccccagcaccctg
ctggctgaagtctgcgtggagcagtgcaccttcatggactccaagatgaagcccctgtgg
atcatgtacagcaacgaggaggcaggcagtggcggcagcgtgggcatcatctttaagaat
ggggatgacctccggcaggacatgctgaccctgcagatgatccagctcatggacgtcctg
tggaagcaggaggggctggacctgaggatgaccccctatggctgcctccccaccggggac
cgcacaggcctcattgaggtggtactccgttcagacaccatcgccaacatccaactcaac
aagagcaacatggcagccacagctgcattcaacaaggacgccctgctcaactggctgaag
tccaagaacccaggggaggccctggatcgagccattgaggagttcaccctctcctgtgct
ggctattgtgtggccacatacgtgctgggcatcggcgatcggcacagcgacaacatcatg
atccgagagagtgggcagctgttccacattgattttggccactttctggggaatttcaag
accaagtttggaatcaaccgcgagcgtgtcccattcatcctcacctatgactttgtccat
gtgattcagcaggggaagactaataatagtgagaaatttgaacggttccggggctactgt
gaaagggcctacaccatcctgcggcgccacgggcttctcttcctccacctctttgccctg
atgcgggcggcaggcctgcctgagctcagctgctccaaagacatccagtatctcaaggac
tccctggcactggggaaaacagaggaggaggcgctgaagcacttccgagtgaagtttaac
gaagccctccgtgagagctggaaaaccaaagtgaactggctggcccacaacgtgtccaaa
gacaacaggcagtag

DBGET integrated database retrieval system