KEGG   Pongo abelii (Sumatran orangutan): 100173619Help
Entry
100173619         CDS       T01416                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00010  Glycolysis / Gluconeogenesis
pon00030  Pentose phosphate pathway
pon00051  Fructose and mannose metabolism
pon00052  Galactose metabolism
pon01100  Metabolic pathways
pon01200  Carbon metabolism
pon01230  Biosynthesis of amino acids
pon03018  RNA degradation
pon04152  AMPK signaling pathway
pon05230  Central carbon metabolism in cancer
Module
pon_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100173619 (PFKP)
   00030 Pentose phosphate pathway
    100173619 (PFKP)
   00051 Fructose and mannose metabolism
    100173619 (PFKP)
   00052 Galactose metabolism
    100173619 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100173619 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100173619 (PFKP)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    100173619 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100173619 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100173619 (PFKP)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100173619 (PFKP)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100173619 (PFKP)
Messenger RNA biogenesis [BR:pon03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100173619 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100173619
NCBI-ProteinID: NP_001126622
Ensembl: ENSPPYG00000002046
UniProt: Q5R636
LinkDB All DBs
Position
10
AA seq 784 aa AA seqDB search
MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVCFI
YEGYQGMVDGGSNIAEADWESVSSILQVGGTIIGSARCQAFRTREGRLKAACNLLQRGIT
NLCVIGGDGSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGNHAVRLPLMEC
VQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGA
PAAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTK
RVLPGKYLEEIATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYIFEEPFDIRDLQSSVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAKLKETRGRGKKFTTDDSVCVL
GISKRNVIFQPVAELKKQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQ
PWSV
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggacgcggacgactcccgggcccccaagggctccttgcggaagttcctggagcacctc
tccggggccggcaaggccatcggcgtgctgaccagcggcggggatgctcaaggtatgaac
gctgccgtccgtgccgtggtgcgcatgggtatctacgtgggggccaaggtgtgcttcatc
tatgagggctaccagggcatggtggacggaggctcgaacatcgcggaggctgactgggag
agcgtctccagcatcctgcaagtgggtgggacgatcattggcagcgcgcggtgccaggcc
ttccgcacgcgggaaggccgcctgaaggctgcctgcaacctgctgcagcgtggcatcacc
aacctgtgtgtgatcggcggggacgggagcctcaccggggccaacctcttccggaaggag
tggagcgggctgctggaggagctggccaggaacggccagatcgataaggaggccgtgcag
aagtacgcctacctcaacgtggtgggcatggtgggctccatcgacaatgacttctgcggc
accgacatgaccatcggcactgactccgccctgcacaggatcattgaggttgttgacgcc
atcatgaccacggcccagagccaccagaggaccttcgttctggaggtgatgggacgacac
tgtgggtacctggccctggtgagtgccttggcctgcggtgcagactgggtgttccttcca
gaatctccgccagaggaaggctgggaggagcagatgtgtgtcaaactctcggagaaccgt
gcccggaaaaaaaggctgaatattattattgtggccgaaggagcaattgatacccaaaat
aaacccattacctctgagaaaatcaaagagctcgtcgtcacgcagctgggctacgataca
cgtgtgaccatcctcgggcacgtgcagagaggagggaccccttcggcattcgacaggatc
ttggccagccgcatgggagtggaggcagtcattgccttgctagaggccaccccggacacc
ccagcttgtgtcgtgtcactgaacgggaaccacgccgtgcgcctgccgctgatggagtgc
gtgcagatgactcaggatgtgcagaaggcgatggacgagaggagatttcaagatgcggtt
cgactccgagggaggagctttgcgggcaacctgaacacctacaagcgacttgccatcaag
ctgccagatgatcagatcccaaagaccaattgcaacgtggctgtcatcaacgtgggggca
cccgcggctgggatgaacgcagccgtacgctcagctgtgcgcgttggcattgccgacggc
cacaggatgctcgccatctatgatggctttgacggcttcgccaagggccagatcaaagaa
atcggctggacagatgtcgggggctggaccggccaaggaggctccattcttgggacaaaa
cgcgttctcccggggaagtacttagaggagatcgccacacagatgcgcacgcacagcatc
aacgcgctgctgatcatcggtggatttgaggcctacctgggactcctggagctgtcagcc
gcccgggagaagcacgaggagttctgtgtccccatggtcatggttcccgctactgtgtcc
aacaatgtgccgggttccgatttcagcatcggggcagacacagccctgaacactatcacc
gacacctgcgaccgcatcaagcagtccgccagcggaaccaagcggcgcgtgttcatcatc
gagaccatgggcggctactgcggctacctggccaacatgggggggctcgcggccggagct
gatgctgcatacatttttgaagagcccttcgacatcagggatctgcagtccagtgtggag
cacctgacggagaaaatgaagaccaccatccagagagggcttgtgctcagaaatgagagc
tgcagtgaaaactacaccaccgacttcatttaccagctctattcggaagagggcaaaggc
gtgtttgactgtaggaagaacgtgctgggccacatgcagcagggtggggcaccctctcca
tttgatagaaactttggaaccaaaatctctgccagagctatggagtggatcactgcgaaa
ctcaaggagacccggggcagaggaaaaaaatttaccaccgatgattccgtttgtgtgctg
ggaataagcaaaagaaacgttatttttcaacctgtggcagagctgaagaagcaaacggat
tttgagcacaggattcccaaagaacagtggtggctcaagctacggcccctcatgaagatc
ctggccaagtacaaggccagctacgacgtgtcggactcaggccagctggagcacgtgcag
ccctggagtgtctga

DBGET integrated database retrieval system