KEGG   Pongo abelii (Sumatran orangutan): 100173631Help
Entry
100173631         CDS       T01416                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial precursor
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00020  Citrate cycle (TCA cycle)
pon00190  Oxidative phosphorylation
pon01100  Metabolic pathways
pon01200  Carbon metabolism
pon04714  Thermogenesis
pon04932  Non-alcoholic fatty liver disease (NAFLD)
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05016  Huntington disease
Module
pon_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pon_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pon_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100173631 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100173631 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100173631 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    100173631 (SDHA)
   05012 Parkinson disease
    100173631 (SDHA)
   05016 Huntington disease
    100173631 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100173631 (SDHA)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100173631 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 100173631
NCBI-ProteinID: NP_001126633
UniProt: Q5R616 A0A2J8XSC5
LinkDB All DBs
Position
5
AA seq 664 aa AA seqDB search
MSGVRGLSRLLSARRLALAKAWPTVLQTGARGFHFTVDGNKRASAKVSDSISAQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIE
DGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPE
KDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDK
VPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCGKIS
KLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVR
IDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVSTGKVTLEYRPVIDKTLNEADCATVPPA
IRSY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtcaggggcctgtcgcggctgctgagcgctcggcgcctggcgctggccaag
gcgtggccaacagtgttgcaaacaggagcccgaggttttcacttcactgttgatgggaac
aagagggcatccgctaaagtttcagattccatttctgctcagtatccagtagtggatcat
gaatttgatgcagtggtggtaggcgctggaggggcaggcttgcgagctgcatttggcctt
tccgaggcagggtttaatacagcatgtgttaccaagctgtttcctaccaggtcacacact
gttgcagcgcagggaggaatcaatgctgctctggggaacatggaggaggacaactggagg
tggcatttctacgacaccgtgaagggctccgactggctgggggaccaggatgccatccac
tacatgacggagcaggcccctgctgccgtggtcgagctagaaaattatggcatgccgttt
agcagaactgaagatgggaagatttatcagcgtgcatttggtggacagagcctcaagttt
ggaaagggcgggcaggcccatcggtgctgctgtgtggctgatcggactggccactcacta
ttgcacaccttatatggaaggtctctgcgatatgataccagctattttgtggagtatttt
gccttggatctcctgatggagaatggggagtgccgtggtgtcatcgcactgtgcatagag
gacgggtccatccatcgcataagagcaaagaacactgttgttgccacaggaggctacggg
cgcacctacttcagctgcacgtctgcccacaccagcactggcgatggcacggccatgatc
accagggcaggcctcccttgccaggacctagagtttgttcagttccaccccacaggcata
tacggtgctggttgtctcattacggaaggatgtcgtggagagggaggcattctcattaac
agtcaaggtgaaaggtttatggagcgatacgcccctgtcgcgaaggacctggcgtctaga
gatgtggtgtctcgttcgatgactctggagatccgagaaggaagaggctgtggccctgag
aaagatcatgtctacctgcagctgcaccacctacctccagagcagctggccacacgcctg
cctggcatttcagagacagccatgatcttcgctggcgtggatgtcacgaaggagccgatc
ccggtcctccccaccgtgcattataacatgggcggcattcccaccaactacaaggggcag
gtcctgaggcacgtgaatggccaggatcagattgtgcccggcctgtacgcctgtggggag
gccgcctgtgcctcggtacatggtgccaaccgcctcggggcaaactcgctcttggacctg
gttgtctttggtcgggcatgtgccctgagcattgaagagtcatgcagacctggagataaa
gtccctccaattaaaccaaacgctggggaagaatctgtcatgaatcttgacaaattgaga
tttgctgatggaagcataagaacatcggaactgcgactcagcatgcagaagtcaatgcaa
aatcatgctgccgtgttccgtgtgggaagcgtgttgcaggaaggttgtgggaaaatcagc
aagctctatggagacctaaagcacctgaagacgttcgaccggggaatggtctggaacacg
gacctggtggagaccctggagctgcagaacctgatgctgtgtgcgctgcagaccatctac
ggagcagaggcacggaaggagtcacggggtgcgcacgccagggaagactacaaggtgcgg
attgatgagtacgattactccaagcccatccaggggcaacagaagaagccctttgaggag
cactggaggaagcacaccctgtcctatgtggacgtcagcactgggaaggtcaccctggaa
tatagacccgtaatcgacaaaactttgaacgaggctgactgtgccaccgtccccccagcc
attcgctcctactga

DBGET integrated database retrieval system