KEGG   Pongo abelii (Sumatran orangutan): 100173719
Entry
100173719         CDS       T01416                                 

Gene name
DKFZP469M1914
Definition
(RefSeq) major histocompatibility complex, class I, C precursor
  KO
K06751  MHC class I antigen
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04145  Phagosome
pon04218  Cellular senescence
pon04514  Cell adhesion molecules
pon04612  Antigen processing and presentation
pon04940  Type I diabetes mellitus
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05203  Viral carcinogenesis
pon05320  Autoimmune thyroid disease
pon05330  Allograft rejection
pon05332  Graft-versus-host disease
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100173719 (DKFZP469M1914)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100173719 (DKFZP469M1914)
   04145 Phagosome
    100173719 (DKFZP469M1914)
  09143 Cell growth and death
   04218 Cellular senescence
    100173719 (DKFZP469M1914)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100173719 (DKFZP469M1914)
   04612 Antigen processing and presentation
    100173719 (DKFZP469M1914)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100173719 (DKFZP469M1914)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100173719 (DKFZP469M1914)
   05330 Allograft rejection
    100173719 (DKFZP469M1914)
   05332 Graft-versus-host disease
    100173719 (DKFZP469M1914)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100173719 (DKFZP469M1914)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100173719 (DKFZP469M1914)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100173719 (DKFZP469M1914)
   05170 Human immunodeficiency virus 1 infection
    100173719 (DKFZP469M1914)
   05168 Herpes simplex virus 1 infection
    100173719 (DKFZP469M1914)
   05163 Human cytomegalovirus infection
    100173719 (DKFZP469M1914)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100173719 (DKFZP469M1914)
   05169 Epstein-Barr virus infection
    100173719 (DKFZP469M1914)
   05165 Human papillomavirus infection
    100173719 (DKFZP469M1914)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100173719 (DKFZP469M1914)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
    100173719 (DKFZP469M1914)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100173719 (DKFZP469M1914)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
 Antigens
  100173719 (DKFZP469M1914)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig DUF1822 Podoplanin
Other DBs
NCBI-GeneID: 100173719
NCBI-ProteinID: NP_001126718
UniProt: Q5R5P6
LinkDB
Position
6
AA seq 366 aa
MRAMAPRTLLLLLSGALALTETWAGSHSMRYFYTAVSRPGRGDPRFVAVGYVDDTQFVRF
DSDAASPRGEPRAPWVEQEGPEYWDQETQSYKRQAQYDRVSLRNLRGYYNQSEDGSHTIQ
SMYGCYVGPDGRLLSGYNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQW
RAYLEGLCVGSLRRYLENGKETLQRTEPPKTHVTHHPVSNHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYACHVQHEGLPEPITLRWEP
SSQSTITIVGIVAGLAVLVVLAVLGAVVTTVMCRRKSSGGKGGSCSQAACSNSAQGSDES
LIACKA
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgcgggccatggcgccccgaaccctcctcctgctactctcgggggccctggccctgacc
gagacctgggccggctcccactccatgaggtatttctacaccgccgtgtcccggcccggc
cgaggagacccccgcttcgtcgcagtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgcgagtccgagaggggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggaccaggagacacagagctacaagcgccaggcacagtatgaccgagtg
agcctgaggaacctgcgcggctactacaaccagagcgaggacgggtctcacaccatccag
agcatgtatggctgctacgtggggcccgacgggcgcctcctcagcgggtataaccagtac
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcctggaccgccgcg
gacacggcggctcagatcacccagcgcaagtgggaggcggcccgtgaggcggagcagtgg
agagcctacctggagggcctgtgcgtggggtcgctccgcagatacctggagaacgggaag
gagacgctgcagcgcacggaacccccaaagacacacgtgacccaccaccccgtctctaac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggaccaaactcaggacactgagcttgtggagaccaggccagca
ggagatggaaccttccagaagtgggcagctgtggtggtgccttctggacaagagcagaga
tacgcgtgccatgtgcagcacgaggggctgccggagcccatcaccctgagatgggagccg
tcttcccagtccaccatcaccatcgtgggcatcgttgctggcctggctgtcctggttgtc
ctagctgtcctaggagctgtggtcaccactgtgatgtgtaggaggaagagctcaggtgga
aaaggagggagctgctctcaggctgcgtgcagcaacagtgcccagggctctgatgagtct
ctcattgcttgtaaagcctga

KEGG   Pongo abelii (Sumatran orangutan): 100189734
Entry
100189734         CDS       T01416                                 

Definition
(RefSeq) DKFZP469I0912 protein isoform X1
  KO
K06751  MHC class I antigen
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04145  Phagosome
pon04218  Cellular senescence
pon04514  Cell adhesion molecules
pon04612  Antigen processing and presentation
pon04940  Type I diabetes mellitus
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05203  Viral carcinogenesis
pon05320  Autoimmune thyroid disease
pon05330  Allograft rejection
pon05332  Graft-versus-host disease
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100189734
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100189734
   04145 Phagosome
    100189734
  09143 Cell growth and death
   04218 Cellular senescence
    100189734
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100189734
   04612 Antigen processing and presentation
    100189734
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100189734
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100189734
   05330 Allograft rejection
    100189734
   05332 Graft-versus-host disease
    100189734
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100189734
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100189734
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100189734
   05170 Human immunodeficiency virus 1 infection
    100189734
   05168 Herpes simplex virus 1 infection
    100189734
   05163 Human cytomegalovirus infection
    100189734
   05167 Kaposi sarcoma-associated herpesvirus infection
    100189734
   05169 Epstein-Barr virus infection
    100189734
   05165 Human papillomavirus infection
    100189734
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100189734
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
    100189734
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100189734
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
 Antigens
  100189734
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 ig CYYR1
Other DBs
NCBI-GeneID: 100189734
NCBI-ProteinID: XP_024104834
LinkDB
Position
6
AA seq 405 aa
MRAMAPRTLLLLLSGALAPTETWAGECGVGRERASAERSERTAGGGAGPGEPRREEGRAG
LSPSSPPGSHSMRYFSTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAVSPRVEPLVPLIE
QEGPEYWDQETQKAKTQAQNDRVSLRNLRGYYNQSEDGSHTWQRMYGCDVGPDGRLLRGY
CQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLCVESLRRYLE
NGKETLQRADCPKTHVTHHPVSEHETILRCWALGFYPAEITLTWQRDGEDQTQDTELVET
RPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQSTIPIVGIVAGLAV
LAVVVIGIVVPAVMCRRKSSGEKGGSYSQAACSDTTQGSDVSLTA
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgcgggccatggcgccccgaaccctcctcctgctgctctcgggggccctggccccgacc
gagacctgggccggtgagtgcggggtcgggagggaaagggcctctgcggagaggagcgag
cggaccgcaggcgggggcgcaggacccggggagccgcgccgggaggagggtcgggcgggt
ctcagcccctcctcgcccccaggctcccactccatgaggtatttcagcaccgccgtgtcc
cggcccggccgcggggagccccgcttcatcgcagtgggctacgtggacgacacccagttc
gtgcggttcgacagcgacgccgtgagtccgagggtggagccgctggtgccattgatagag
caggaggggccggagtattgggaccaggagacacagaaagccaagacccaggcacagaat
gaccgagtgagcctgcggaacctgcgcggctactacaaccagagcgaggacgggtctcac
acctggcagaggatgtatggctgcgacgtggggcccgacgggcgccttctccgtgggtat
tgccagttcgcctacgacggcaaggattacatcgccctgaacgaggacctgagctcttgg
accgccgcggacaccgcggctcagatcacccagcgcaagtgggaggcggcccgtgaggcg
gagcagttgagagcctacctggagggcctgtgcgtggagtcgctccgcagatacctggag
aacgggaaggagacattgcagcgcgcggactgcccaaagacacacgtgacccaccacccc
gtctctgaacatgagactatcctgagatgctgggccctgggcttctaccctgcggagatc
acactgacctggcagcgggatggggaggaccaaactcaggacaccgagcttgtggagacc
aggccagcaggagatggaaccttccagaagtgggcagcggtggtggtgccttctggagaa
gagcagagatacacatgccatgtgcagcacgaggggctgccggagcccctcaccctgaga
tgggagccatcttcccaatctaccatccccatcgtgggcattgttgctggcctggctgtc
ctagcagttgtggtcattggaattgtggtccccgctgtgatgtgtaggaggaagagctca
ggtgagaaaggagggagctactctcaggctgcatgcagcgacactacccagggctctgat
gtgtctctcacggcttga

KEGG   Pongo abelii (Sumatran orangutan): 100432875
Entry
100432875         CDS       T01416                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, alpha chain F isoform X1
  KO
K06751  MHC class I antigen
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04145  Phagosome
pon04218  Cellular senescence
pon04514  Cell adhesion molecules
pon04612  Antigen processing and presentation
pon04940  Type I diabetes mellitus
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05203  Viral carcinogenesis
pon05320  Autoimmune thyroid disease
pon05330  Allograft rejection
pon05332  Graft-versus-host disease
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100432875
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100432875
   04145 Phagosome
    100432875
  09143 Cell growth and death
   04218 Cellular senescence
    100432875
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100432875
   04612 Antigen processing and presentation
    100432875
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100432875
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100432875
   05330 Allograft rejection
    100432875
   05332 Graft-versus-host disease
    100432875
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100432875
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100432875
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100432875
   05170 Human immunodeficiency virus 1 infection
    100432875
   05168 Herpes simplex virus 1 infection
    100432875
   05163 Human cytomegalovirus infection
    100432875
   05167 Kaposi sarcoma-associated herpesvirus infection
    100432875
   05169 Epstein-Barr virus infection
    100432875
   05165 Human papillomavirus infection
    100432875
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100432875
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
    100432875
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100432875
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
 Antigens
  100432875
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig MHC_I_3 C2-set_2 Ig_2 Trp_oprn_chp MHC_I_C
Other DBs
NCBI-GeneID: 100432875
NCBI-ProteinID: XP_009239874
Ensembl: ENSPPYG00000016398
LinkDB
Position
6
AA seq 365 aa
MAPRTLLLLLSGALALTETWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSD
AAIPRMEPRAPWVEQEGPQYWEWTTGYAKANAQTDRVALKNLLRRYNQSEAGSHTLQGMN
GCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRIY
LEGECLELLRRYLENGKETLQRADPPKAHIAHHPISDHEATLRCWALGFYPAEITLTWQR
DGEEQTQDTELVETRPTGDGTFQKWAAVVVPSGEEQRYTCHVQHKGLPEPLTLRWEQSPQ
PTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGSYSQAAKRRGKHKIHYKQSKE
GKCLC
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggcgccccgaaccctcctcctgctgctctcaggggccctggccctgaccgagacctgg
gcgggctcccactccttgaggtatttcagcaccgctgtgtcgcggcccggccgcggggag
ccccggtacatcgccgtggagtacgtggacgacacgcagttcctgcggtttgacagcgac
gcggcgattccgaggatggagccgcgggcgccgtgggtggagcaagaggggccgcagtat
tgggagtggaccacagggtacgccaaggccaacgcacagactgaccgagtggccctgaag
aacctgctccgccgctacaaccagagcgaggccggatctcacaccctccagggaatgaat
ggctgcgacatggggcccgacggacgcctcctccgcgggtatcaccagcacgcgtacgac
ggcaaggattacatctccctgaacgaggacctgcgctcctggaccgcggcggacaccgtg
gctcagatcacccagcgcttctatgaggcagaggaatatgcagaggagttcaggatctac
ctggagggcgagtgcctagagttgctccgcagatacctggagaacgggaaggagacgcta
cagcgcgcagatcccccaaaggcacacattgcccaccaccccatctctgaccatgaggcc
accctgaggtgctgggccctgggcttctaccctgccgagatcacgctcacctggcagcgg
gatggggaggaacagacccaggacacagagcttgtggagaccaggcctacaggggatgga
accttccagaagtgggccgctgtggtggtgccttctggagaggaacagagatacacctgc
catgtgcagcacaaggggctgcccgagcccctcaccctgagatgggagcagtctccccag
cccaccatccccatcgtgggcatcgttgctggccttgttgtccttggagctgtggtcact
ggagctgtggtcgctgctgtaatgtggaggaagaagagctcagatagaaacagagggagc
tactctcaggctgcaaagagaagaggcaaacacaagatacactataagcagagtaaggaa
ggaaaatgcttgtgttag

KEGG   Pongo abelii (Sumatran orangutan): 100435133
Entry
100435133         CDS       T01416                                 

Definition
(RefSeq) saoe class I histocompatibility antigen, A alpha chain-like
  KO
K06751  MHC class I antigen
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04145  Phagosome
pon04218  Cellular senescence
pon04514  Cell adhesion molecules
pon04612  Antigen processing and presentation
pon04940  Type I diabetes mellitus
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05203  Viral carcinogenesis
pon05320  Autoimmune thyroid disease
pon05330  Allograft rejection
pon05332  Graft-versus-host disease
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100435133
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100435133
   04145 Phagosome
    100435133
  09143 Cell growth and death
   04218 Cellular senescence
    100435133
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100435133
   04612 Antigen processing and presentation
    100435133
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100435133
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100435133
   05330 Allograft rejection
    100435133
   05332 Graft-versus-host disease
    100435133
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100435133
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100435133
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100435133
   05170 Human immunodeficiency virus 1 infection
    100435133
   05168 Herpes simplex virus 1 infection
    100435133
   05163 Human cytomegalovirus infection
    100435133
   05167 Kaposi sarcoma-associated herpesvirus infection
    100435133
   05169 Epstein-Barr virus infection
    100435133
   05165 Human papillomavirus infection
    100435133
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100435133
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
    100435133
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100435133
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
 Antigens
  100435133
SSDB
Motif
Pfam: MHC_I
Other DBs
NCBI-GeneID: 100435133
NCBI-ProteinID: XP_024104285
LinkDB
Position
6
AA seq 213 aa
MDWGGAALGIPHLRRVSLRPLPTCVRSFFLDTHRAAPVLTPIESRVSREANQCSRGPGSK
VPTHPPGPRFSPVAEDGVMAPRTLLLLLSGALALTQTWAGFHSLRYFHTTMSRPGRGDPR
FISVGYVDDTQCVRFDSDATSPRMEPRAPWMEQERPEYWEEETGTAKANSQLYRVNLRTL
SGYYNQSEAWAASHTVMDRFLQTQLSASLYETL
NT seq 642 nt   +upstreamnt  +downstreamnt
atggattggggaggtgcagcgttggggattccccatctccgcagggtttctcttcgccct
ctcccaacctgcgtcaggtccttcttcctggatactcaccgggcggccccagttctcact
cccattgagagtcgggtttctagagaagccaatcaatgtagccgcggtcccggttctaaa
gttcccacgcacccaccgggaccccgattctccccagtcgccgaggatggggtcatggcg
ccccgaaccctccttctgctgctctcgggggccctggccctgacccagacctgggcgggc
ttccactccttgaggtatttccacaccaccatgtcccggcccggccgcggggatccccgc
ttcatctccgtgggctacgtggacgacacccagtgcgtgcggttcgacagcgacgccacg
agtcccaggatggagccgcgagcgccgtggatggagcaggagaggccggaatattgggag
gaagagacagggaccgccaaggccaactcacagctttaccgagtgaacctgcggaccctg
agcggctactacaaccagagcgaggcctgggctgccagccacacagtcatggacaggttt
ctacagacacaacttagtgccagcttgtatgaaaccctctga

KEGG   Pongo abelii (Sumatran orangutan): 100435866
Entry
100435866         CDS       T01416                                 

Definition
(RefSeq) popy Class I histocompatibility antigen, A-1 alpha chain
  KO
K06751  MHC class I antigen
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04145  Phagosome
pon04218  Cellular senescence
pon04514  Cell adhesion molecules
pon04612  Antigen processing and presentation
pon04940  Type I diabetes mellitus
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05203  Viral carcinogenesis
pon05320  Autoimmune thyroid disease
pon05330  Allograft rejection
pon05332  Graft-versus-host disease
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100435866
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100435866
   04145 Phagosome
    100435866
  09143 Cell growth and death
   04218 Cellular senescence
    100435866
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100435866
   04612 Antigen processing and presentation
    100435866
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100435866
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100435866
   05330 Allograft rejection
    100435866
   05332 Graft-versus-host disease
    100435866
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100435866
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100435866
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100435866
   05170 Human immunodeficiency virus 1 infection
    100435866
   05168 Herpes simplex virus 1 infection
    100435866
   05163 Human cytomegalovirus infection
    100435866
   05167 Kaposi sarcoma-associated herpesvirus infection
    100435866
   05169 Epstein-Barr virus infection
    100435866
   05165 Human papillomavirus infection
    100435866
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100435866
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
    100435866
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100435866
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
 Antigens
  100435866
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set Ig_3 C2-set_2 ig DUF2755
Other DBs
NCBI-GeneID: 100435866
NCBI-ProteinID: XP_024104294
Ensembl: ENSPPYG00000016402
LinkDB
Position
6
AA seq 365 aa
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPRFITVGYVDDTQFVRF
DSDAASPRMEPRAPWIEQEGPEYWDRETRSAKAHAQTDRVDLGTLRGYYNQSDGGSHTIQ
RMYGCDVGPDGRFLRGYRQYAYDGKDYIALNGDLRSWTAADMAAQITQRKWEAAGEAEQR
RAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHRISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGKEQRYTCLVQHEGLPEPLTLRWEP
SSQPTIPIVGIVAGLVLLGAVITGAVVAAVMWRRRSSDRKGGSYSQAASNDSAQGSDVSL
TACKV
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggcggtcatggcgccccgaaccctcctcctgctactctcgggggccctggccctgacc
cagacctgggcgggctcccactctatgaggtatttctacacctccgtgtcccggcccggc
cgcggggagccccgcttcatcaccgtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgcgagcccgaggatggagccgcgggcgccatggatagagcaggagggg
ccggagtattgggaccgggagacacggagcgcgaaggcccacgcacagactgaccgagtg
gacctggggacgctgcgcggctactacaaccagagcgacggcggttctcacaccatccag
aggatgtatggctgcgacgtggggcccgacgggcgcttcctccgcgggtaccggcagtac
gcctacgacggcaaggattacatcgccctaaacggggacctgcgctcctggaccgcggcg
gacatggcggctcagatcacccagcgcaagtgggaggcggccggtgaggcggagcagcgg
agagcctacctggagggcacgtgcgtggagtggctccgcagatacctggagaacgggaag
gagactctgcagcgcacggatgcccccaagacacatatgactcaccaccgcatctctgac
catgaggccaccctgaggtgctgggccttgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggaccagacccaggacacggagctcgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcagctgtggtggtgccttctggaaaggagcagaga
tacacctgccttgtgcagcatgagggtctgcctgagcccctcaccctgagatgggagcca
tcttcccagcccaccatccccatcgtgggcatcgttgctggcctggttcttcttggagct
gtgatcactggagctgtggtcgctgctgtgatgtggaggaggaggagctcagatagaaaa
ggagggagctactctcaggctgcaagcaatgacagtgcccagggctctgatgtgtctctc
acagcttgtaaagtgtga

KEGG   Pongo abelii (Sumatran orangutan): 100438533
Entry
100438533         CDS       T01416                                 

Definition
(RefSeq) patr class I histocompatibility antigen, B-2 alpha chain isoform X1
  KO
K06751  MHC class I antigen
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04145  Phagosome
pon04218  Cellular senescence
pon04514  Cell adhesion molecules
pon04612  Antigen processing and presentation
pon04940  Type I diabetes mellitus
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05203  Viral carcinogenesis
pon05320  Autoimmune thyroid disease
pon05330  Allograft rejection
pon05332  Graft-versus-host disease
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100438533
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100438533
   04145 Phagosome
    100438533
  09143 Cell growth and death
   04218 Cellular senescence
    100438533
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100438533
   04612 Antigen processing and presentation
    100438533
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100438533
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100438533
   05330 Allograft rejection
    100438533
   05332 Graft-versus-host disease
    100438533
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100438533
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100438533
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100438533
   05170 Human immunodeficiency virus 1 infection
    100438533
   05168 Herpes simplex virus 1 infection
    100438533
   05163 Human cytomegalovirus infection
    100438533
   05167 Kaposi sarcoma-associated herpesvirus infection
    100438533
   05169 Epstein-Barr virus infection
    100438533
   05165 Human papillomavirus infection
    100438533
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100438533
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
    100438533
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100438533
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
 Antigens
  100438533
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 ig CYYR1 PTP_tm
Other DBs
NCBI-GeneID: 100438533
NCBI-ProteinID: XP_024104832
LinkDB
Position
6
AA seq 391 aa
MRIMAPRTLLLLLSAALALTETWAGSHSMKYFYTGMSRPGRGEPRFISVGYVDDTQFVWF
DSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTYREGLRILRGYYNQSEDGSHTWQ
RMYGCDVGPDGRLLRGYDQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARWAEQF
RAYLEGRCVESLRRYLENGKETLQRAEPPRTHMTHHPISDHETTLRCWALGFYPAEITLT
WQRDREDLTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP
SSQSTIPIVGIVAGLAVLAVVVIGIVVAAVMCRRKSSGGKGGSYSQAACKWWGWECGGAH
RPHNSSCPTSPAGSDRVLFLFYPRQRQCPGL
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgcggatcatggcgccccgaaccctcctcctgctgctctcggcggccctggccctgacc
gagacctgggccggctcccactccatgaagtatttctacacgggcatgtcccggcccggc
cgcggggagccccgcttcatctccgtgggctacgtggacgacacgcagttcgtgtggttc
gacagcgacgccgcgagtccgagagaggagccgcgggcgccatggatagagcaggagggg
ccggagtattgggaccggaacacacagatctgcaagaccaacacacagacttaccgagag
ggcctgcggatcctgcgcggctactacaaccagagcgaggacgggtctcacacctggcag
aggatgtatggctgcgacgtggggcccgacgggcgcctcctccgcgggtatgaccagttc
gcctacgacggcaaggattacatcgccctgaacgaggacctgagctcctggaccgccgcg
gacaccgcggctcagatcacccagcgcaagtgggaggcggcccgttgggcggagcagttc
agagcctacctggagggccggtgcgtggagtcgctccgcagatacctggagaacgggaag
gagacgctgcagcgcgcggagcccccaaggacacacatgacccaccatcccatctctgac
catgagactaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatagggaggacctgacccaggacaccgagcttgtggagaccaggccagca
ggcgatggaaccttccagaagtgggcagctgtggtggtgccttctggagaagagcagaga
tacacatgccatgtgcaacacgaggggctgccggagcccctcaccctgagatgggagcca
tcttcccagtccaccatccccatcgtgggcattgttgctggcctggctgtcctagcagtt
gtggtcatcggaattgtggtcgctgctgtgatgtgtaggaggaagagctcaggtgggaaa
ggagggagctactctcaggctgcgtgtaagtggtgggggtgggagtgtggaggagctcac
cgaccccataattcctcctgccccacgtcccctgcgggctctgaccgggtcctatttttg
ttctaccccaggcagcgacagtgcccagggctctga

KEGG   Pongo abelii (Sumatran orangutan): 100440558
Entry
100440558         CDS       T01416                                 

Definition
(RefSeq) popy class I histocompatibility antigen, alpha chain E isoform X3
  KO
K06751  MHC class I antigen
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04145  Phagosome
pon04218  Cellular senescence
pon04514  Cell adhesion molecules
pon04612  Antigen processing and presentation
pon04940  Type I diabetes mellitus
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05203  Viral carcinogenesis
pon05320  Autoimmune thyroid disease
pon05330  Allograft rejection
pon05332  Graft-versus-host disease
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100440558
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100440558
   04145 Phagosome
    100440558
  09143 Cell growth and death
   04218 Cellular senescence
    100440558
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100440558
   04612 Antigen processing and presentation
    100440558
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100440558
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100440558
   05330 Allograft rejection
    100440558
   05332 Graft-versus-host disease
    100440558
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100440558
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100440558
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100440558
   05170 Human immunodeficiency virus 1 infection
    100440558
   05168 Herpes simplex virus 1 infection
    100440558
   05163 Human cytomegalovirus infection
    100440558
   05167 Kaposi sarcoma-associated herpesvirus infection
    100440558
   05169 Epstein-Barr virus infection
    100440558
   05165 Human papillomavirus infection
    100440558
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100440558
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
    100440558
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100440558
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
 Antigens
  100440558
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 MHC_I_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 100440558
NCBI-ProteinID: XP_009239891
Ensembl: ENSPPYG00000016407
LinkDB
Position
6
AA seq 342 aa
MTHGTLLLLLSEALALTETWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDND
AASPRMVPRAQWMEQEGPEYWDRETRSARDTAQTFRVNLRTLRGYYNQTEAGSHTLQWMH
GCDLGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISERKSNDACEAEHQRAY
LEDTCVEWLRKYLEKGKETLLHLDPPKTHVTHHRISDHEATLRCWALGFYPAEITLTWQR
DGEDQNQYTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPASQ
TTIPIVGIFAGLVLLGAVVTGATVVAAVMWRKKSSGMGLVAL
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgactcatgggaccctccttttactcctctcggaggccctagcccttaccgagacctgg
gcgggctcccactccttgaagtatttccacacttccgtgtcccggcccggccgcggggag
ccccgcttcatctctgtgggctacgtggacgacacccagttcgtgcgctttgacaacgac
gccgcgagtccgaggatggtgccgcgggcgcagtggatggagcaggaggggccagagtat
tgggaccgggagacacggagcgccagggacaccgcacagactttccgagtgaacctgcgg
accctgcgcggctactacaatcagaccgaggccgggtctcacaccctgcagtggatgcat
ggctgcgacctggggcccgacgggcgcttcctccgcgggtatgaacagttcgcctacgac
ggcaaggattatctcaccctgaatgaggacctgcgctcctggaccgcggtggacacggcg
gctcagatctccgagcgaaagtcaaatgatgcctgtgaggcggagcaccagagagcctac
ctggaagacacatgcgtggagtggctccgcaaatacctggagaaggggaaggagacgctg
cttcacctggatcccccaaagacacatgtgacccaccaccgcatctctgaccatgaggcc
accctgaggtgctgggccctgggcttctaccctgcggagatcacactgacctggcagcgg
gatggggaggaccagaaccagtacacagagcttgtggagaccaggcctgccggggatgga
accttccagaagtgggcagctgtggtggtgccttctggagaggagcagagatacacgtgc
catgtgcagcatgaggggctacccgaacccctcaccctgagatgggagccggcttcccag
accaccatccccatcgtgggcatctttgctggcctggttctccttggagctgtggtcact
ggagctactgtggttgctgctgtgatgtggaggaagaagagctcaggaatgggactggtg
gctttataa

KEGG   Pongo abelii (Sumatran orangutan): 100449631
Entry
100449631         CDS       T01416                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: patr class I histocompatibility antigen, A-126 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04145  Phagosome
pon04218  Cellular senescence
pon04514  Cell adhesion molecules
pon04612  Antigen processing and presentation
pon04940  Type I diabetes mellitus
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05203  Viral carcinogenesis
pon05320  Autoimmune thyroid disease
pon05330  Allograft rejection
pon05332  Graft-versus-host disease
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100449631
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100449631
   04145 Phagosome
    100449631
  09143 Cell growth and death
   04218 Cellular senescence
    100449631
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100449631
   04612 Antigen processing and presentation
    100449631
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100449631
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100449631
   05330 Allograft rejection
    100449631
   05332 Graft-versus-host disease
    100449631
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100449631
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100449631
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100449631
   05170 Human immunodeficiency virus 1 infection
    100449631
   05168 Herpes simplex virus 1 infection
    100449631
   05163 Human cytomegalovirus infection
    100449631
   05167 Kaposi sarcoma-associated herpesvirus infection
    100449631
   05169 Epstein-Barr virus infection
    100449631
   05165 Human papillomavirus infection
    100449631
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100449631
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
    100449631
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100449631
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
 Antigens
  100449631
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set ig
Other DBs
NCBI-GeneID: 100449631
NCBI-ProteinID: XP_024104289
LinkDB
Position
6
AA seq 446 aa
MGWGGAALGIPNLCRVSLLPLPTCDGSFFMDTHDADPVLTPTESQVSREANQXSRGPGSK
VPTHPPGLGVSPDAEDGVMAPRTLLLLLSGTLALAETWAGSHSLRYFSTAVSQPGRGEPR
FIAEGYVDDTQFVRFDSDAASPRMKTRLRWVEQEGPEYWDLQTLGAKAQAQTDRVNLRTL
LRYYNQSEAGYHILQGMFGCDLGPDGRLLRGYEQYAYDGKGYIALNEDLRSWTAADTAAQ
ITQRKWEVANVAEQRRAYLVSTCVEWLCRHLEKGKETLQRADPPKTHVTHHPVSEHEATL
RCWALGFYPAEITLTWQRDREDQIQDTEFMETRPAGDGTFQKWVAMVLPSGEEQRYMCHV
QHKGLPKPLTLRWEPSPQPTIPIMGIVAGLVVLGAVVTGAVVAAMMWRKKSSGCFLPTDR
KGGSYSQAASSQSAQGSDVSLTACKV
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgggctggggaggtgcagcgttggggattcctaatctctgcagagtttctcttctccct
ctcccaacctgcgacgggtccttcttcatggacactcacgacgcggatccagttctcact
cccactgagagtcaggtttctagagaagccaatcagncgtcgcgcggccccggttctaaa
gtccccacgcacccaccgggactcggagtctccccagacgccgaggatggggtcatggcg
ccccgaaccctcctcctgctgctctcggggaccctggccctggccgagacctgggcgggc
tcccactccttgaggtatttcagcaccgccgtttcccagccgggccgcggggagccccgc
ttcatcgccgagggctacgtggacgacacgcagttcgtgcggttcgacagtgacgccgcg
agcccgaggatgaagacgcggttgcggtgggtggagcaggaggggccggagtattgggac
ctacagacactgggcgccaaggcccaggcacagactgaccgagtgaacctgcggaccctg
ctccgctactacaaccagagcgaggcggggtatcacatcctccagggaatgtttggctgc
gacctggggcccgatgggcgtctcctccgcgggtatgagcagtatgcctacgacggcaag
ggttacatcgccctgaacgaggacctgcgctcctggaccgccgcggacaccgcggctcag
atcacccagcgcaagtgggaggtggctaatgtggctgagcaaaggagagcctacctggtg
agcacctgcgtggagtggctctgcagacacctggagaaagggaaagagacgctgcagcgc
gcggacccccccaagacacacgtgacccaccaccctgtctctgaacatgaggccaccctg
aggtgctgggccctgggcttctaccctgcggagatcacactgacctggcagcgggatagg
gaggaccagatccaggacacggagttcatggagaccaggcctgcaggggatggaaccttc
cagaagtgggtggctatggtgttgccttctggagaggaacagagatacatgtgccatgtg
cagcacaaggggctgcccaagcccctcaccctgagatgggagccatctccccagcccacc
atccccattatgggcatcgttgctggcctggttgtccttggagctgtggtcactggagct
gtggtcgctgctatgatgtggaggaagaagagctcaggatgttttcttcccacagataga
aaaggagggagctactctcaggctgctagtagccaaagtgcccagggctctgatgtgtct
ctcacggcttgtaaagtgtga

KEGG   Pongo abelii (Sumatran orangutan): 100450716
Entry
100450716         CDS       T01416                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, alpha chain G isoform X1
  KO
K06751  MHC class I antigen
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04145  Phagosome
pon04218  Cellular senescence
pon04514  Cell adhesion molecules
pon04612  Antigen processing and presentation
pon04940  Type I diabetes mellitus
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05203  Viral carcinogenesis
pon05320  Autoimmune thyroid disease
pon05330  Allograft rejection
pon05332  Graft-versus-host disease
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100450716
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100450716
   04145 Phagosome
    100450716
  09143 Cell growth and death
   04218 Cellular senescence
    100450716
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100450716
   04612 Antigen processing and presentation
    100450716
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100450716
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100450716
   05330 Allograft rejection
    100450716
   05332 Graft-versus-host disease
    100450716
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100450716
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100450716
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100450716
   05170 Human immunodeficiency virus 1 infection
    100450716
   05168 Herpes simplex virus 1 infection
    100450716
   05163 Human cytomegalovirus infection
    100450716
   05167 Kaposi sarcoma-associated herpesvirus infection
    100450716
   05169 Epstein-Barr virus infection
    100450716
   05165 Human papillomavirus infection
    100450716
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100450716
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
    100450716
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100450716
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
 Antigens
  100450716
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 100450716
NCBI-ProteinID: XP_024104281
LinkDB
Position
6
AA seq 390 aa
MSWTHTETQGYGMKFSLPLGDGFLEKPISVAAVPVLKYSLTHPDSDSPQTPRMVVMAPRT
LLLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAVGYVDDTQFVRFDSDSASPR
MEPRAPWVEQEGPEYWEEETRNTKAHAQTDRLNLQILRGYYNQSEAGSHTLQWMIGCDLG
PDGRLLRGYEQYAYDGKDYLALNKDLRSWTAADTAAQISKRKCEAGNVAEQRRAYLEGTC
VEWLHRYLENGKEMLQRAEPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQ
TQDVELVETRPAGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPEPLMLRWKQSSQPTIPI
MGIIAGLVVLAVVVTGAVAAAVLWRKKSSD
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgtcctggactcacacggaaactcagggctatggaatgaagttctcactcccattaggt
gacgggtttttagagaagccaatcagcgtcgccgcggtcccggttctaaagtactcgctc
acccacccggactcagattctccccagacgccaaggatggtggtcatggcgccccgaacc
ctcctgctgctgctctcgggggcgctgaccctgaccgagacctgggcgggctcccactcc
atgaggtatttcagcgccgccgtgtcccggcccggtcgcggggagccccgcttcattgcc
gtgggctacgtggacgacacgcagttcgtgcggttcgacagcgactcggcgagtccgagg
atggagccgcgggcgccgtgggtggagcaggaggggccggagtattgggaagaggagaca
cggaacaccaaggcccacgcacagactgacagactgaacctgcagatcctgcgcggctac
tacaaccagagcgaggcgggttctcacaccctccagtggatgattggctgcgacctgggg
cccgacgggcgcctcctccgcgggtatgaacagtatgcctacgatggcaaggattacctc
gccctgaacaaggacctgcgctcctggaccgcagcggacactgcggctcagatctccaag
cgcaagtgtgaggcgggcaatgtggctgaacaaaggagagcctacctggagggcacgtgc
gtggagtggctccacagatacctggagaacgggaaggagatgctgcagcgcgcggaaccc
cccaagacacacgtgacccaccaccctgtctttgactatgaggccaccctgaggtgctgg
gccctgggcttctaccctgcggagatcatactgacctggcagcgggatggggaggaccag
acccaggacgtggagcttgtggagaccaggcctgcaggggatggaaccttccagaagtgg
gcagctgtggtggtgcctcctggagaggagcagagatacacgtgccatgtgcagcatgag
gggctgccggagcccctcatgctgagatggaagcagtcttcccagcccaccatccccatc
atgggtatcattgctggcctggttgtccttgcagttgtagtcactggagctgtggccgct
gctgtgctgtggaggaagaagagctcagattga

KEGG   Pongo abelii (Sumatran orangutan): 100452132
Entry
100452132         CDS       T01416                                 

Definition
(RefSeq) class I histocompatibility antigen, Gogo-B*0102 alpha chain isoform X1
  KO
K06751  MHC class I antigen
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04145  Phagosome
pon04218  Cellular senescence
pon04514  Cell adhesion molecules
pon04612  Antigen processing and presentation
pon04940  Type I diabetes mellitus
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05203  Viral carcinogenesis
pon05320  Autoimmune thyroid disease
pon05330  Allograft rejection
pon05332  Graft-versus-host disease
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100452132
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100452132
   04145 Phagosome
    100452132
  09143 Cell growth and death
   04218 Cellular senescence
    100452132
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100452132
   04612 Antigen processing and presentation
    100452132
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100452132
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100452132
   05330 Allograft rejection
    100452132
   05332 Graft-versus-host disease
    100452132
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100452132
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100452132
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100452132
   05170 Human immunodeficiency virus 1 infection
    100452132
   05168 Herpes simplex virus 1 infection
    100452132
   05163 Human cytomegalovirus infection
    100452132
   05167 Kaposi sarcoma-associated herpesvirus infection
    100452132
   05169 Epstein-Barr virus infection
    100452132
   05165 Human papillomavirus infection
    100452132
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100452132
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
    100452132
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100452132
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
 Antigens
  100452132
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 ig MHC_I_3 CYYR1 PTP_tm
Other DBs
NCBI-GeneID: 100452132
NCBI-ProteinID: XP_024104828
LinkDB
Position
6
AA seq 359 aa
MAPRTLLLLLSEVLALTETWAGSHSMRYFDTSVSRPGRGEPRFITVGYVDDTQFVRFDSD
AASPRMEPRVPCIEQEGPEYWDQETQKAKASAQTDRVSLRTLLRYYNQSEDGSHTWQRMY
GCYVGPDGRLLRGYDQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARWAEQLRAY
LEGRCVQWLRRYLENGKETLQRADPPKTHVTHHPNSDHETTLRCWALGFYPAEITLTWQR
DGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWKPSSQ
STIPIVGIVAGLAVLAVVVIGIVVAAVMCRRKSSGGKGGSYSQAASSDSVQGSDVSLTA
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcgccccgaaccctcctcctgctgctctcggaggtcctggccctgaccgagacctgg
gccggctcccactccatgaggtatttcgacacctccgtgtcccggcccggccgcggggag
ccccgcttcatcaccgtgggctacgtggatgacacgcagttcgtgcggttcgacagcgac
gccgcgagtccgaggatggagccgcgggtgccatgcatagagcaggaggggccggagtat
tgggaccaggagacacagaaagccaaggcctccgcacagactgaccgagtgagcctgcgg
accctgctccgctactacaaccagagcgaggacgggtctcacacctggcagaggatgtat
ggctgctacgtggggcccgacgggcgcctcctccgcgggtatgaccagtacgcctacgac
ggcaaggattacatcgccctgaacgaggacctgagctcctggaccgctgcggacaccgcg
gctcagatcacccagcgcaagtgggaggcggcccgttgggcggagcagttgagagcctac
ctggagggccggtgcgtgcagtggctccgcagatacctggagaacgggaaggagacgctg
cagcgcgcggaccccccaaagacacacgtgacccaccaccccaactctgaccatgagacc
accctgaggtgctgggccctgggcttctaccctgcggagatcacactgacctggcagcgg
gatggggaggaccagacccaggacacggagcttgtggagaccaggccagcaggagatgga
accttccagaagtgggcagctgtggtggtgccttctggagaagagcagagatacacatgc
catgtgcagcatgaggggctgccggagcccctcaccctgagatggaagccatcttcccag
tccaccatccccatcgtgggcattgttgctggcctggctgtcctagcagttgtggtcatc
ggaattgtggtcgctgctgtgatgtgtaggaggaagagctcaggtggaaaaggagggagc
tactctcaggctgcgtccagcgacagcgtccagggctctgatgtgtctctcacggcttga

KEGG   Pongo abelii (Sumatran orangutan): 100456603
Entry
100456603         CDS       T01416                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: patr class I histocompatibility antigen, A-126 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04145  Phagosome
pon04218  Cellular senescence
pon04514  Cell adhesion molecules
pon04612  Antigen processing and presentation
pon04940  Type I diabetes mellitus
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05203  Viral carcinogenesis
pon05320  Autoimmune thyroid disease
pon05330  Allograft rejection
pon05332  Graft-versus-host disease
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100456603
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100456603
   04145 Phagosome
    100456603
  09143 Cell growth and death
   04218 Cellular senescence
    100456603
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100456603
   04612 Antigen processing and presentation
    100456603
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100456603
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100456603
   05330 Allograft rejection
    100456603
   05332 Graft-versus-host disease
    100456603
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100456603
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100456603
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100456603
   05170 Human immunodeficiency virus 1 infection
    100456603
   05168 Herpes simplex virus 1 infection
    100456603
   05163 Human cytomegalovirus infection
    100456603
   05167 Kaposi sarcoma-associated herpesvirus infection
    100456603
   05169 Epstein-Barr virus infection
    100456603
   05165 Human papillomavirus infection
    100456603
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100456603
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
    100456603
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100456603
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
 Antigens
  100456603
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set C2-set_2 ig LapA_dom
Other DBs
NCBI-GeneID: 100456603
NCBI-ProteinID: XP_024104288
LinkDB
Position
6
AA seq 438 aa
MDWGGPASGIPHLXAVSLLLTTCTRSFLDIHDADPVLTPTGCRVSREANQCRRGPGSKVP
THPPGLRFSPDAEDGVMAPRTLLLLLSGAPALTQTWAGSHSMRYFSTSVSRPGRGEPRYL
EVGYVDDTQFVRFDSDAASPRMELRASWVQQEGPEYWDRNTRRAKANAQTDRVDLGTLRG
YYNQSEAGSHTIQRMYGCEVGSHGRFLRGYRQDAYDGKDYIALNEDLRSWTAADIAAQII
KRKWEAAGVGEQERAYLEGTCVEWLRRHLKNGKETLQRTDPPKTHMTHHPISDHEATLRC
WALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGKEQRYTCHVQH
EGLPEPLTLRWEPSSQPTIPIVVIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGRYSQA
ASSDSAQGSDVSLTACKV
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggattggggaggtccagcatcggggattccccatctcnncgcagtttctcttcttctt
acaacctgcacccggtccttcctcgatattcacgacgcggacccagttctcactcccact
gggtgtcgggtttctagagaagccaatcagtgtcgtcgcggtcctggttctaaagtcccc
acgcacccaccgggactccgattctccccagatgccgaggatggcgtcatggcgccccga
accctcctcctgctactctcgggtgccccggccctgacccagacctgggcgggctcccac
tccatgaggtatttcagcacctccgtgtcccggccgggccgcggggagccccggtacctc
gaagtcggctacgtggacgacacgcagttcgtgcggttcgacagcgacgccgcgagcccg
aggatggagctgcgggcgtcgtgggtgcagcaggaggggccagagtattgggaccggaac
acacggagagccaaggccaacgcacagactgaccgagtggacctagggaccctgcgcggc
tactacaaccagagcgaggccggttctcacaccatccagaggatgtatggctgcgaagtg
gggtcccacgggcgcttcctccgcgggtaccggcaggacgcctacgacggcaaggattac
atcgccctaaacgaggacctgcgctcttggaccgcggcggacattgcagctcagatcatc
aagcgcaagtgggaggcggccggtgtgggggagcaggagagagcctacctggagggcacg
tgcgtggagtggctccgcagacacctgaagaacgggaaggagacgctgcagcgcacggac
ccccccaagacacatatgacccaccaccccatctctgaccatgaggccaccctgaggtgc
tgggccctgggcttctaccctgcggagatcacactgacctggcagcgggatggggaggac
cagacccaggacacggagctcgtggagaccaggcctgcaggggatggaaccttccagaag
tgggtggctgtggtggtgccttctggaaaggagcagagatacacctgccatgtgcagcat
gagggtctgcctgagcccctcaccctgagatgggagccgtcttcccagcccaccatcccc
atcgtggtcatcattgctggcctggttctccttggagctgtgatcactggagctgtggtc
gctgctgtgatgtggaggaggaagagctcagatagaaaaggagggagatactctcaggct
gcaagcagtgacagtgcccagggctctgatgtgtctctcacagcttgtaaagtgtga

DBGET integrated database retrieval system