KEGG   Pongo abelii (Sumatran orangutan): 100173739
Entry
100173739         CDS       T01416                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04510  Focal adhesion
pon04520  Adherens junction
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04670  Leukocyte transendothelial migration
pon04916  Melanogenesis
pon04919  Thyroid hormone signaling pathway
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
pon05160  Hepatitis C
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05210  Colorectal cancer
pon05213  Endometrial cancer
pon05215  Prostate cancer
pon05216  Thyroid cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100173739 (CTNNB1)
   04310 Wnt signaling pathway
    100173739 (CTNNB1)
   04390 Hippo signaling pathway
    100173739 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100173739 (CTNNB1)
   04520 Adherens junction
    100173739 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100173739 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100173739 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100173739 (CTNNB1)
   04916 Melanogenesis
    100173739 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100173739 (CTNNB1)
   05205 Proteoglycans in cancer
    100173739 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100173739 (CTNNB1)
   05225 Hepatocellular carcinoma
    100173739 (CTNNB1)
   05226 Gastric cancer
    100173739 (CTNNB1)
   05216 Thyroid cancer
    100173739 (CTNNB1)
   05217 Basal cell carcinoma
    100173739 (CTNNB1)
   05215 Prostate cancer
    100173739 (CTNNB1)
   05213 Endometrial cancer
    100173739 (CTNNB1)
   05224 Breast cancer
    100173739 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100173739 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    100173739 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100173739 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100173739 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100173739 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100173739 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    100173739 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100173739 (CTNNB1)
   05163 Human cytomegalovirus infection
    100173739 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100173739 (CTNNB1)
   05165 Human papillomavirus infection
    100173739 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 100173739
NCBI-ProteinID: NP_001126737
Ensembl: ENSPPYG00000013986
UniProt: Q5R5L8 A0A6D2XVM0
LinkDB
Position
3
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctactcaagctgatttgatggagttggacatggccatggaaccagacagaaaagcg
gctgttagtcactggcagcaacagtcttacctggactctggaatccattctggtgccact
accacagctccttctctgagtggtaaaggcaatcctgaggaagaggatgtggatacctcc
caagttctgtatgagtgggagcagggattttctcagtccttcactcaagaacaagtagct
gatattgatggacagtatgcaatgactcgagctcagagggtacgagctgctatgttcccc
gagacattagatgagggcatgcagatcccgtctacacagtttgatgctgctcatcccact
aatgtccagcgtttggctgaaccatcacagatgctgaaacatgcagttgtaaacttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatccctgaactgacaaaactgcta
aatgacgaggaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgctatcatgcgttctcctcagatggtgtctgctattgtacgt
accatgcagaatacaaatgatgtagaaacagctcgttgtaccgctgggaccttgcataac
ctttcccatcatcgtgagggcttactggccatctttaagtctggaggcattcctgccctg
gtgaaaatgcttggttcaccagtggattctgtgttgttttatgccattacaactctccac
aaccttttattacatcaagaaggagctaaaatggcagtgcgtttagctggtgggctgcag
aaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacgacagactgc
cttcaaattttagcttatggcaaccaagaaagcaagctcatcatactggctagtggtgga
ccccaagctttagtaaatataatgaggacctatacttatgaaaaactactgtggaccaca
agcagagtgctgaaggtgctatctgtctgctctagtaataagccggctattgtagaagct
ggtggaatgcaagctttaggacttcacctgacagatccaagtcaacgtcttgttcagaac
tgtctttggactctcaggaatctttcagatgctgcaactaaacaggaagggatggaaggt
ctccttgggactcttgttcagcttctgggttcagatgatataaatgtggtcacctgtgca
gctggaattctttctaacctcacttgcaataattataagaacaagatgatggtctgccaa
gtgggtggtatagaggctcttgtgcgtactgtccttcgggctggtgacagggaagacatc
actgagcctgccatctgtgctcttcgtcatctgaccagccgacaccaagaagcagagatg
gcccagaatgcagttcgccttcactatggactaccagttgtggttaagctcttacaccca
ccatcccactggcctctgataaaggctaccgttggattgattagaaatcttgccctttgt
cccgcaaatcatgcacctttgcgtgagcagggtgccattccacgactagttcagttgctt
gttcgtgcacatcaggatacccagcgccgtacgtccatgggtgggacacagcagcaattt
gtggagggggtccgcatggaagaaatagttgaaggttgtaccggagcccttcacatccta
gctcgggatgttcacaaccgaattgttatcagaggactaaataccattccattgtttgtg
cagctgctttattctcccattgaaaacatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaagctgcagaagctattgaagctgagggagccacagctcctctg
acagagttacttcactctaggaatgaaggtgtggcgacatatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaagattacaagaaacggctttcagttgagctgaccagc
tctctcttcagaacagagcccatggcttggaatgagactgctgatcttggacttgatatt
ggtgcccagggagaaccccttggatatcgccaggatgatcctagctatcgttcttttcac
tctggtggatatggccaggatgccttgggtatggaccccatgatggaacatgagatgggt
ggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcatgcccag
gacctcatggatgggctgcctccaggtgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system