KEGG   Pongo abelii (Sumatran orangutan): 100173769
Entry
100173769         CDS       T01416                                 

Gene name
HNRNPK
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein K
  KO
K12886  heterogeneous nuclear ribonucleoprotein K
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03040  Spliceosome
pon05203  Viral carcinogenesis
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100173769 (HNRNPK)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100173769 (HNRNPK)
   05203 Viral carcinogenesis
    100173769 (HNRNPK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pon03041]
    100173769 (HNRNPK)
Spliceosome [BR:pon03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    100173769 (HNRNPK)
SSDB
Motif
Pfam: KH_1 ROKNT KH_2 KH_4 KH_5 MOEP19 DJ-1_PfpI
Other DBs
NCBI-GeneID: 100173769
NCBI-ProteinID: NP_001126766
Ensembl: ENSPPYG00000019327
UniProt: Q5R5H8 A0A2J8WPB8
LinkDB
Position
9
AA seq 464 aa
METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGK
GGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTAT
SQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKL
FQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFT
MMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRG
GSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMA
YEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS
IKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYADVEGF
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggaaactgaacagccagaagaaaccttccctaacactgaaaccaatggtgaatttggt
aaacgccctgcagaagatatggaagaggaacaagcatttaaaagatctagaaacactgat
gagatggttgaattacgcattctgcttcagagcaagaatgctggggcagtgattggaaaa
ggaggcaagaatattaaggctctccgtacagactacaatgccagtgtttcagtcccagac
agcagtggccccgagcgcatattgagtatcagtgctgatattgaaacaattggagaaatt
ctgaagaaaatcatccctaccttggaagagggcctgcagttgccatcacccactgcaacc
agccagctcccgctcgaatctgatgctgtggaatgcttaaattaccaacactataaagga
agtgactttgactgcgagttgaggctgttgattcatcagagtctagcaggaggaattatt
ggggtcaaaggtgctaaaatcaaagaacttcgagagaacactcaaaccaccatcaagctt
ttccaggaatgctgtcctcattccactgacagagttgttcttattggaggaaaacccgat
agggttgtagagtgcataaagatcatccttgatcttatatctgagtctcccatcaaagga
cgtgcacagccttacgatcccaatttttacgatgaaacctatgattatggtggttttaca
atgatgtttgatgaccgccgtggacgcccagtgggatttccaatgcggggaagaggtggt
tttgacagaatgcctcctggtcggggtgggcgtcccatgcctccatctagaagagattat
gatgatatgagccctcgtcgaggaccacctccccctcctcctggacgaggcggccggggt
ggtagcagagctcggaatcttcctcttcctccaccaccaccacctagagggggagacctc
atggcctatgacagaagagggagacctggagaccgttacgatggcatggttggtttcagt
gctgatgaaacttgggactctgcaatagatacatggagcccatcagaatggcagatggct
tatgaaccacagggtggctctggatatgattattcctatgcagggggtcgtggctcatat
ggtgatcttggtggacctattattactacacaagtaactattcccaaagatttggctgga
tctattattggcaaaggtggtcagcggattaaacaaatccgtcatgagtcgggagcttcg
atcaaaattgatgagcctttagaaggatccgaagatcggatcattaccattacaggaaca
caggaccagatacagaatgcacagtatttgctgcagaacagtgtgaagcagtatgcagat
gttgaaggattctaa

DBGET integrated database retrieval system