KEGG   Pongo abelii (Sumatran orangutan): 100173832
Entry
100173832         CDS       T01416                                 

Gene name
ACTB
Definition
(RefSeq) actin, cytoplasmic 1
  KO
K05692  actin beta/gamma 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04145  Phagosome
pon04210  Apoptosis
pon04390  Hippo signaling pathway
pon04510  Focal adhesion
pon04520  Adherens junction
pon04530  Tight junction
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04670  Leukocyte transendothelial migration
pon04714  Thermogenesis
pon04810  Regulation of actin cytoskeleton
pon04919  Thyroid hormone signaling pathway
pon04921  Oxytocin signaling pathway
pon04971  Gastric acid secretion
pon05014  Amyotrophic lateral sclerosis
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
pon05135  Yersinia infection
pon05164  Influenza A
pon05205  Proteoglycans in cancer
pon05225  Hepatocellular carcinoma
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
pon05416  Viral myocarditis
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100173832 (ACTB)
   04390 Hippo signaling pathway
    100173832 (ACTB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100173832 (ACTB)
  09143 Cell growth and death
   04210 Apoptosis
    100173832 (ACTB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100173832 (ACTB)
   04520 Adherens junction
    100173832 (ACTB)
   04530 Tight junction
    100173832 (ACTB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100173832 (ACTB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100173832 (ACTB)
   04613 Neutrophil extracellular trap formation
    100173832 (ACTB)
   04670 Leukocyte transendothelial migration
    100173832 (ACTB)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100173832 (ACTB)
   04919 Thyroid hormone signaling pathway
    100173832 (ACTB)
  09154 Digestive system
   04971 Gastric acid secretion
    100173832 (ACTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    100173832 (ACTB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100173832 (ACTB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100173832 (ACTB)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100173832 (ACTB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100173832 (ACTB)
   05410 Hypertrophic cardiomyopathy
    100173832 (ACTB)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100173832 (ACTB)
   05414 Dilated cardiomyopathy
    100173832 (ACTB)
   05416 Viral myocarditis
    100173832 (ACTB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100173832 (ACTB)
   05135 Yersinia infection
    100173832 (ACTB)
   05100 Bacterial invasion of epithelial cells
    100173832 (ACTB)
  09172 Infectious disease: viral
   05164 Influenza A
    100173832 (ACTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pon03021]
    100173832 (ACTB)
   03019 Messenger RNA biogenesis [BR:pon03019]
    100173832 (ACTB)
   03036 Chromosome and associated proteins [BR:pon03036]
    100173832 (ACTB)
   03029 Mitochondrial biogenesis [BR:pon03029]
    100173832 (ACTB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100173832 (ACTB)
   04147 Exosome [BR:pon04147]
    100173832 (ACTB)
Transcription machinery [BR:pon03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100173832 (ACTB)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100173832 (ACTB)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100173832 (ACTB)
    NuA4 complex
     100173832 (ACTB)
  Chromatin remodeling factors
   BAF complex
    100173832 (ACTB)
   PBAF complex
    100173832 (ACTB)
   SWR1 complex
    100173832 (ACTB)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100173832 (ACTB)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100173832 (ACTB)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100173832 (ACTB)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 100173832
NCBI-ProteinID: NP_001126826
Ensembl: ENSPPYG00000017336
UniProt: Q5R6G0
LinkDB
Position
7
AA seq 375 aa
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVNIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgatgatatcgccgcgctcgtcgtcgacaacggctccggcatgtgcaaggccggc
ttcgcgggcgacgatgccccccgggccgtctttccctccatcgtggggcgccccaggcac
cagggcgtgatggtgggcatgggtcagaaggattcctatgtgggcgacgaagcccagagc
aagagaggcatcctcaccctgaagtaccccatcgagcacggcatcgtcaccaactgggat
gacatggagaagatctggcaccacaccttctacaatgagctgcgtgtggctcccgaggag
caccccgtgctgctgaccgaggcccccctgaaccccaaggccaaccgcgagaagatgacc
cagatcatgtttgaaaccttcaacaccccagccatgtacgtggctatccaggctgtgctg
tccctgtacgcctctggccgtaccactggcatcgtgatggactccggtgacggggtcacc
cacactgtgcccatctacgaggggtatgccctcccccatgccatcctgcgtctggacctg
gctggccgggacctgactgactacctcatgaagatcctcaccgagcgcggctacagcttc
accaccacggccgagcgggaaatcgtgcgtgacattaaggagaagctgtgctacgtcgcc
ctggacttcgagcaggagatggccacggctgcttccagctcctccctggagaagagctac
gagctgcccgatggccaggtcatcaccattggcaacgagcggttccgctgccccgaggcg
ctcttccagccttccttccttggcatggagtcctgtggcattcacgaaactaccttcaac
tccatcatgaagtgtgacgtgaacatccgcaaagacctgtacgccaacacagtgctgtct
ggcggcaccaccatgtaccctggcattgccgacaggatgcagaaggagatcaccgccctg
gcacccagcaccatgaagatcaagatcattgctcctcctgagcgcaagtactccgtgtgg
atcggcggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtatgacgagtccggcccctccatcgtccaccgcaaatgcttctag

KEGG   Pongo abelii (Sumatran orangutan): 100441387
Entry
100441387         CDS       T01416                                 

Gene name
ACTG1
Definition
(RefSeq) actin, cytoplasmic 2
  KO
K05692  actin beta/gamma 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04145  Phagosome
pon04210  Apoptosis
pon04390  Hippo signaling pathway
pon04510  Focal adhesion
pon04520  Adherens junction
pon04530  Tight junction
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04670  Leukocyte transendothelial migration
pon04714  Thermogenesis
pon04810  Regulation of actin cytoskeleton
pon04919  Thyroid hormone signaling pathway
pon04921  Oxytocin signaling pathway
pon04971  Gastric acid secretion
pon05014  Amyotrophic lateral sclerosis
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
pon05135  Yersinia infection
pon05164  Influenza A
pon05205  Proteoglycans in cancer
pon05225  Hepatocellular carcinoma
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
pon05416  Viral myocarditis
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100441387 (ACTG1)
   04390 Hippo signaling pathway
    100441387 (ACTG1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100441387 (ACTG1)
  09143 Cell growth and death
   04210 Apoptosis
    100441387 (ACTG1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100441387 (ACTG1)
   04520 Adherens junction
    100441387 (ACTG1)
   04530 Tight junction
    100441387 (ACTG1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100441387 (ACTG1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100441387 (ACTG1)
   04613 Neutrophil extracellular trap formation
    100441387 (ACTG1)
   04670 Leukocyte transendothelial migration
    100441387 (ACTG1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100441387 (ACTG1)
   04919 Thyroid hormone signaling pathway
    100441387 (ACTG1)
  09154 Digestive system
   04971 Gastric acid secretion
    100441387 (ACTG1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100441387 (ACTG1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100441387 (ACTG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100441387 (ACTG1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100441387 (ACTG1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100441387 (ACTG1)
   05410 Hypertrophic cardiomyopathy
    100441387 (ACTG1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100441387 (ACTG1)
   05414 Dilated cardiomyopathy
    100441387 (ACTG1)
   05416 Viral myocarditis
    100441387 (ACTG1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100441387 (ACTG1)
   05135 Yersinia infection
    100441387 (ACTG1)
   05100 Bacterial invasion of epithelial cells
    100441387 (ACTG1)
  09172 Infectious disease: viral
   05164 Influenza A
    100441387 (ACTG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pon03021]
    100441387 (ACTG1)
   03019 Messenger RNA biogenesis [BR:pon03019]
    100441387 (ACTG1)
   03036 Chromosome and associated proteins [BR:pon03036]
    100441387 (ACTG1)
   03029 Mitochondrial biogenesis [BR:pon03029]
    100441387 (ACTG1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100441387 (ACTG1)
   04147 Exosome [BR:pon04147]
    100441387 (ACTG1)
Transcription machinery [BR:pon03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100441387 (ACTG1)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100441387 (ACTG1)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100441387 (ACTG1)
    NuA4 complex
     100441387 (ACTG1)
  Chromatin remodeling factors
   BAF complex
    100441387 (ACTG1)
   PBAF complex
    100441387 (ACTG1)
   SWR1 complex
    100441387 (ACTG1)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100441387 (ACTG1)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100441387 (ACTG1)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100441387 (ACTG1)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 100441387
NCBI-ProteinID: XP_009250409
Ensembl: ENSPPYG00000008735
UniProt: A0A6D2XWB9 A0A2J8Y2J6
LinkDB
Position
17
AA seq 375 aa
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggaagaagagatcgccgcgctcgtcattgacaatggctccggcatgtgcaaagctggc
tttgctggggacgacgctccccgagccgtgtttccttccatcgtcgggcgccccagacac
cagggcgtgatggtgggcatgggccagaaggactcctacgtgggcgacgaggcccagagc
aagcgtggcatcctgaccctgaagtaccccatcgagcatggcatcgtcaccaactgggac
gacatggagaagatctggcaccacactttctacaacgagctgcgcgtggctccggaggag
catccagtgctgctgaccgaggcccccctgaaccccaaggccaacagagagaagatgact
cagattatgtttgagaccttcaacaccccggccatgtacgtggccatccaggccgtgctg
tccttgtacgcttctgggcgcaccactggcattgtcatggactctggagacggggtcacc
cacacggtgcccatctacgagggctacgccctcccccacgctatcctgcgtctggacctg
gctggccgggacctgaccgactacctcatgaagatcctcaccgagcgaggctacagcttc
accaccacggccgagcgggaaatcgtgcgcgacatcaaggagaagctgtgctacgtcgcc
ctggatttcgagcaggagatggccaccgccgcatcctcctcttcgctggagaagagctac
gagctgcctgatggccaggtcatcaccattggcaatgagcggttccggtgtccggaggcg
ctgttccagccttctttcttgggcatggaatcttgcggcatccacgagaccaccttcaac
tccattatgaagtgtgacgtggatatccgcaaagacctgtacgccaacacggtgctgtcc
ggcggcaccaccatgtacccaggcattgccgacaggatgcagaaggagatcactgccctg
gcgcccagtaccatgaagatcaagatcattgcacccccagagcgcaagtactcagtgtgg
atcggcggctccatcctggcctcactgtccaccttccagcagatgtggattagcaagcag
gagtacgacgagtcgggcccctccatcgtccatcgcaaatgcttctaa

DBGET integrated database retrieval system