KEGG   Pongo abelii (Sumatran orangutan): 100173964
Entry
100173964         CDS       T01416                                 

Gene name
PRKCI
Definition
(RefSeq) protein kinase C iota type
  KO
K06069  atypical protein kinase C iota type [EC:2.7.11.13]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04144  Endocytosis
pon04390  Hippo signaling pathway
pon04530  Tight junction
pon04611  Platelet activation
pon04910  Insulin signaling pathway
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100173964 (PRKCI)
   04390 Hippo signaling pathway
    100173964 (PRKCI)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100173964 (PRKCI)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100173964 (PRKCI)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100173964 (PRKCI)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100173964 (PRKCI)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100173964 (PRKCI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100173964 (PRKCI)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100173964 (PRKCI)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100173964 (PRKCI)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 C1_1 Pkinase_C Kinase-like Kdo APH C1_2
Other DBs
NCBI-GeneID: 100173964
NCBI-ProteinID: NP_001126946
Ensembl: ENSPPYG00000014289
UniProt: Q5R4K9
LinkDB
Position
3
AA seq 587 aa
MSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMK
WIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGEDKSIYRRGA
RRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIE
CGRHSLPPEPMMPMDQSSMHSDHAQTVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSL
GLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQA
SNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYL
HERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGED
YGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKA
ASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGL
DNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgtcccacacggtcgcaggcggcggcagcggggaccattcccaccaggtccgggtgaaa
gcctactaccgcggggatatcatgataactcattttgaaccttccatctcctttgagggc
ctttgcaatgaggttcgagacatgtgttcttttgacaacgaacagctcttcaccatgaaa
tggatagatgaggaaggagacccgtgtacagtatcatctcagttggagttagaagaagcc
tttagactttatgagctaaacaaggattctgaactcttgattcatgtgttcccttgtgta
ccagaacgtcctgggatgccttgtccaggagaagataaatccatctaccgtagaggtgca
cgccgctggagaaagctttattgtgccaatggccacactttccaagccaagcgtttcaac
aggcgtgctcactgtgccatctgcacagaccgaatatggggacttggacgccaaggatat
aagtgcatcaactgcaaactcttggttcataagaagtgccataaactcgtcacaattgaa
tgtgggcggcattctttgccaccggaaccaatgatgcccatggatcagtcatccatgcat
tctgaccatgcacagacagtaattccatataatccttcaagtcatgagagtttggatcaa
gttggtgaagaaaaagaggcaatgaacaccagggaaagtggcaaagcttcatccagtcta
ggtcttcaggattttgatttgctccgggtaataggaagaggaagttatgccaaagtactg
ttggttcgattaaaaaaaacagatcgtatttatgcaatgaaagttgtgaaaaaagagctt
gttaatgatgatgaggatattgattgggtgcagacagagaagcatgtgtttgagcaggca
tctaatcatcctttccttgttgggctgcattcttgctttcagacagaaagcagattgttc
tttgtcatagagtatgtaaatggaggagacctaatgtttcatatgcagcgacaaagaaaa
cttcctgaagaacatgccagattttactctgcagaaatcagtctagcattaaattatctt
catgagcgagggataatttatagagatttgaaactggacaatgtattactggactctgaa
ggccacattaaactcactgactatggcatgtgtaaggaaggattacggccaggagataca
accagcactttctgtggtactcctaattacattgctcctgaaattttaagaggagaagat
tatggtttcagtgttgactggtgggctcttggagtgctaatgtttgagatgatggcagga
aggtctccatttgatattgttgggagctccgataaccctgaccaaaacacagaggattat
ctcttccaagttattttggaaaaacaaattcgcataccacgttctctgtctgtaaaagct
gcaagtgttctgaagagttttcttaacaaggaccctaaggaacgattgggttgtcatcct
caaacaggatttgctgatattcagggacacccgttcttccgaaatgttgattgggatatg
atggagcaaaaacaggtggtacctccctttaaaccaaatatttctggggaatttggtttg
gacaactttgattctcagtttactaatgaacctgtccagctcactccggatgacgatgac
attgtgaggaagattgatcagtctgaatttgaaggttttgagtatatcaatcctcttttg
atgtctgcagaagaatgtgtctga

KEGG   Pongo abelii (Sumatran orangutan): 100174126
Entry
100174126         CDS       T01416                                 

Gene name
PRKCZ
Definition
(RefSeq) protein kinase C zeta type
  KO
K18952  atypical protein kinase C zeta type [EC:2.7.11.13]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04062  Chemokine signaling pathway
pon04071  Sphingolipid signaling pathway
pon04144  Endocytosis
pon04360  Axon guidance
pon04390  Hippo signaling pathway
pon04530  Tight junction
pon04611  Platelet activation
pon04910  Insulin signaling pathway
pon04926  Relaxin signaling pathway
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05165  Human papillomavirus infection
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100174126 (PRKCZ)
   04390 Hippo signaling pathway
    100174126 (PRKCZ)
   04071 Sphingolipid signaling pathway
    100174126 (PRKCZ)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100174126 (PRKCZ)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100174126 (PRKCZ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100174126 (PRKCZ)
   04062 Chemokine signaling pathway
    100174126 (PRKCZ)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100174126 (PRKCZ)
   04926 Relaxin signaling pathway
    100174126 (PRKCZ)
  09158 Development and regeneration
   04360 Axon guidance
    100174126 (PRKCZ)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100174126 (PRKCZ)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100174126 (PRKCZ)
   04931 Insulin resistance
    100174126 (PRKCZ)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100174126 (PRKCZ)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100174126 (PRKCZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100174126 (PRKCZ)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100174126 (PRKCZ)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100174126 (PRKCZ)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like APH FTA2 Kdo
Other DBs
NCBI-GeneID: 100174126
NCBI-ProteinID: NP_001127094
UniProt: Q5R944
LinkDB
Position
1
AA seq 409 aa
MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKI
SQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHV
FEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIA
LNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEIL
RGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSV
KASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDY
GLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggattctgtcatgccttcccaagagcctccagtagacgacaagaacgaggacgccgac
cttccttccgaggagacagatggaattgcttacatttcctcatcccggaaacatgacagc
attaaagacgactccgaggaccttaagccagttatcgatgggatggatggaatcaaaatc
tctcaggggcttgggctgcaggacttcgacctaatcagagtcatcgggcgtgggagctac
gccaaggttctcctggtgcggttgaagaagaatgaccaaatctacgccatgaaagtggtg
aagaaagagctggtgcatgatgacgaggatattgactgggtacagacagagaagcacgtg
tttgagcaggcatccagcaaccccttcctggtcggattacactcctgcttccagacgaca
agtcggctgttcctggtcattgagtacgtcaatggcggggacctgatgttccacatgcag
aggcagaggaagctccctgaggagcacgccaggttctatgcggccgagatctgcatcgcc
ctcaacttcctgcacgagagggggatcatctacagggacctgaagctggacaacgtcctc
ctggacgcggatgggcacatcaagctcacagattacggcatgtgcaaggaaggcctgggc
cctggcgacacaacgagcactttctgcggaaccccaaattacatcgcccccgaaatcctg
cggggagaggagtacgggttcagcgtggactggtgggcgctgggagtcctcatgtttgag
atgatggccgggcgctccccgttcgacatcatcaccgacaacccagacatgaacacagag
gactaccttttccaagtgatcctggagaagcccatccggatcccccggttcctgtccgtc
aaagcctcccatgttttaaaaggatttttaaataaggaccccaaagagaggctcggctgc
cggccacagactggattttctgacatcaagtcccacgcgttcttccgcagcatagactgg
gacttgctggagaagaagcaggctctccctccattccagccacagatcacggacgactac
ggtctggacaactttgacacacagttcaccagcgagcccgtgcaactgaccccagacgat
gaggatgccataaagaggatcgaccagtcggagttcgaaggcttcgagtatatcaaccca
ttattgctgtccaccgaggagtcggtgtga

DBGET integrated database retrieval system