KEGG   Pongo abelii (Sumatran orangutan): 100173976
Entry
100173976         CDS       T01416                                 

Gene name
EIF4E2
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 2
  KO
K03259  translation initiation factor 4E
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon03013  RNA transport
pon04066  HIF-1 signaling pathway
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04211  Longevity regulating pathway
pon04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100173976 (EIF4E2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100173976 (EIF4E2)
   04151 PI3K-Akt signaling pathway
    100173976 (EIF4E2)
   04150 mTOR signaling pathway
    100173976 (EIF4E2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100173976 (EIF4E2)
  09149 Aging
   04211 Longevity regulating pathway
    100173976 (EIF4E2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100173976 (EIF4E2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100173976 (EIF4E2)
   03012 Translation factors [BR:pon03012]
    100173976 (EIF4E2)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100173976 (EIF4E2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100173976 (EIF4E2)
Translation factors [BR:pon03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    100173976 (EIF4E2)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 100173976
NCBI-ProteinID: NP_001126957
Ensembl: ENSPPYG00000013282
UniProt: Q5R4J0
LinkDB
Position
2B
AA seq 236 aa
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEYPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKAWEEFHGLVNSSGR
NT seq 711 nt   +upstreamnt  +downstreamnt
atgaacaacaagttcgacgctttgaaagatgatgacagtggggaccatgatcagaatgaa
gaaaacagcacacagaaagatggtgagaaggaaaaaacggaacgagacaagaatcaaagc
agtagcaagagaaaggctgttgtccctggaccggcagagtatcccctgcagtacaactac
actttttggtactccaggagaacccccggccgtcccacgagctcacagagctatgaacag
aatatcaaacagattggcacctttgcctctgtggagcagttctggaggttttatagccac
atggtacgtcccggggacctgacaggccacagtgacttccatctcttcaaagaaggaatt
aaacccatgtgggaggatgatgcaaataaaaatggtggcaagtggattattcggctgcgg
aagggcttggcctcccgttgctgggagaatctcattttggccatgctgggggaacagttc
atggttggggaggagatctgtggggctgtggtgtctgtccgctttcaggaggacattatt
tcaatatggaataagactgccagtgaccaagcaaccacagcccgaatccgggacacactt
cgacgagtgcttaacctacctcccaacaccattatggaatacaaaactcacaccgacagc
atcaaggcctgggaggagtttcatggcctggtgaacagcagcggccgctga

KEGG   Pongo abelii (Sumatran orangutan): 100448282
Entry
100448282         CDS       T01416                                 

Gene name
EIF4E
Definition
(RefSeq) eukaryotic translation initiation factor 4E isoform X1
  KO
K03259  translation initiation factor 4E
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon03013  RNA transport
pon04066  HIF-1 signaling pathway
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04211  Longevity regulating pathway
pon04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100448282 (EIF4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100448282 (EIF4E)
   04151 PI3K-Akt signaling pathway
    100448282 (EIF4E)
   04150 mTOR signaling pathway
    100448282 (EIF4E)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100448282 (EIF4E)
  09149 Aging
   04211 Longevity regulating pathway
    100448282 (EIF4E)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100448282 (EIF4E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100448282 (EIF4E)
   03012 Translation factors [BR:pon03012]
    100448282 (EIF4E)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100448282 (EIF4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100448282 (EIF4E)
Translation factors [BR:pon03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    100448282 (EIF4E)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 100448282
NCBI-ProteinID: XP_024101817
LinkDB
Position
4
AA seq 240 aa
MAELEFQHGEHGSRGCDQKQCISYSDDNLETTPTPNPPTTEEEKTESNQEVANPEHYIKH
PLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDG
IEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVR
AKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 723 nt   +upstreamnt  +downstreamnt
atggcagagctggaattccaacatggggaacatggctctagagggtgtgatcagaagcag
tgcatctcatattctgatgacaatctggaaaccacccctactcctaatcccccgactaca
gaagaggagaaaacggaatctaatcaggaggttgctaacccagaacactatattaaacat
cccctacagaacagatgggcactctggttttttaaaaatgataaaagcaaaacttggcaa
gcaaacctgcggctgatctccaagtttgatactgttgaagacttttgggctctgtacaac
catatccagttgtctagtaatttaatgcctggctgtgactactcactttttaaggatggt
attgagcctatgtgggaagatgagaaaaacaaacggggaggacgatggctaattacattg
aacaaacagcagagacgaagtgacctcgatcgcttttggctagagacacttctgtgcctt
attggagaatcttttgatgactacagtgatgatgtatgtggcgctgttgttaatgttaga
gctaaaggtgataagatagcaatatggactactgaatgtgaaaacagagaagctgttaca
catatagggagggtatacaaggaaaggttaggacttcctccaaagatagtgattggttat
cagtcccacgcagacacagctactaagagcggctccaccactaaaaataggtttgttgtt
taa

KEGG   Pongo abelii (Sumatran orangutan): 100456700
Entry
100456700         CDS       T01416                                 

Gene name
EIF4E1B
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 1B
  KO
K03259  translation initiation factor 4E
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon03013  RNA transport
pon04066  HIF-1 signaling pathway
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04211  Longevity regulating pathway
pon04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100456700 (EIF4E1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100456700 (EIF4E1B)
   04151 PI3K-Akt signaling pathway
    100456700 (EIF4E1B)
   04150 mTOR signaling pathway
    100456700 (EIF4E1B)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100456700 (EIF4E1B)
  09149 Aging
   04211 Longevity regulating pathway
    100456700 (EIF4E1B)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100456700 (EIF4E1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100456700 (EIF4E1B)
   03012 Translation factors [BR:pon03012]
    100456700 (EIF4E1B)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100456700 (EIF4E1B)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100456700 (EIF4E1B)
Translation factors [BR:pon03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    100456700 (EIF4E1B)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 100456700
NCBI-ProteinID: XP_024103217
LinkDB
Position
5
AA seq 249 aa
MEFELGMATAGLASEAEGGIREREEEEKEEEAAERTPTGEKSPNSPRTLLSLKGKARTGG
PMEVKLELHPLQNRWALWFFKNDRSRAWQDNLHLLTKVDTVEDFWALYSHIQLASKLSSG
CDYALFKDGIQPMWEDSRNKRGGRWLVSLAKQQRHIELDRLWLETLLCLIGESFEEHSRE
VCGAVINIRTKGDKIAVWTREAENQAGVLHIGRVYKERLGLSPKTIIGYQAHADTATKSN
SLAKNKFVV
NT seq 750 nt   +upstreamnt  +downstreamnt
atggagtttgagttgggcatggctactgcaggccttgcgagtgaagctgagggtggaatc
cgagagcgggaggaggaggagaaggaggaggaggcagcagagaggacgcccacgggagaa
aagtctccaaactctcccaggactttgctgtctctgaaagggaaggcccggacggggggc
cccatggaagtcaagctggagctgcaccccctgcagaacaggtgggctctgtggttcttc
aagaatgaccgcagccgggcctggcaggataacctgcacctgctcaccaaggtggacact
gtggaggacttctgggcgctatacagtcacatccagctggccagcaagctctcctctggc
tgtgactatgccctgttcaaggatggcatccagcccatgtgggaggacagcaggaataag
cggggtggccgctggctggtcagcctggccaagcagcagcgtcacattgagctggaccgg
ctgtggctggagacgctgctgtgtctgatcggggagagctttgaggaacacagcagggag
gtatgtggggccgtcatcaacatccgcaccaagggggacaagatcgctgtgtggacgagg
gaggcggaaaaccaggcgggcgtgctgcacattgggcgtgtgtacaaagagcgcctgggc
ctctccccaaagaccatcattgggtaccaggcccatgcagacacagccaccaagagcaac
tccctagccaagaacaagtttgtggtgtga

DBGET integrated database retrieval system