KEGG   Pongo abelii (Sumatran orangutan): 100174018
Entry
100174018         CDS       T01416                                 

Gene name
RALB
Definition
(RefSeq) ras-related protein Ral-B precursor
  KO
K07835  Ras-related protein Ral-B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04072  Phospholipase D signaling pathway
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100174018 (RALB)
   04015 Rap1 signaling pathway
    100174018 (RALB)
   04072 Phospholipase D signaling pathway
    100174018 (RALB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100174018 (RALB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100174018 (RALB)
   05212 Pancreatic cancer
    100174018 (RALB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100174018 (RALB)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pon04031]
    100174018 (RALB)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    100174018 (RALB)
GTP-binding proteins [BR:pon04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    100174018 (RALB)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase SRPRB GTP_EFTU MMR_HSR1 Gtr1_RagA AAA_25 FeoB_N Ser_hydrolase
Other DBs
NCBI-GeneID: 100174018
NCBI-ProteinID: NP_001126995
UniProt: Q5R4B8 A0A2J8VM48
LinkDB
Position
2B
AA seq 206 aa
MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDK
IPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKK
MSENKDKNGKKSSKNKKSFKERCCLL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctgccaacaagagtaagggccagagctccttggccctccacaaggtgatcatggtt
ggcagcggaggcgttggcaagtcagccctgacgcttcagttcatgtatgacgagtttgta
gaagactatgaacctaccaaagctgacagttatagaaagaaagtggttcttgatggggaa
gaagttcagatagatattctggacaccgctgggcaagaggactacgcagccattcgagat
aactactttcggagtggggaagggtttcttcttgtgttctcaatcacagaacatgaatcg
tttacagcaactgccgaattcagggaacagattctccgtgtgaaggctgaagaagataaa
attccattgctcgtcgtgggaaacaagtctgacttagaggagcggaggcaggtgcctgtg
gaggaggccaggagtaaagccgaagagtggggtgtgcagtatgtggagacgtcggcgaag
acccgggccaacgtggacaaggtgttctttgacctaatgagagaaatcagaacaaagaag
atgtcagaaaacaaagacaagaatggcaagaaaagcagcaagaacaagaaaagttttaaa
gaaagatgttgcttactatga

KEGG   Pongo abelii (Sumatran orangutan): 100441438
Entry
100441438         CDS       T01416                                 

Gene name
RALA
Definition
(RefSeq) ras-related protein Ral-A
  KO
K07834  Ras-related protein Ral-A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04072  Phospholipase D signaling pathway
pon05132  Salmonella infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100441438 (RALA)
   04015 Rap1 signaling pathway
    100441438 (RALA)
   04072 Phospholipase D signaling pathway
    100441438 (RALA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100441438 (RALA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100441438 (RALA)
   05212 Pancreatic cancer
    100441438 (RALA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100441438 (RALA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100441438 (RALA)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pon04031]
    100441438 (RALA)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    100441438 (RALA)
GTP-binding proteins [BR:pon04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    100441438 (RALA)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 AAA_25 MMR_HSR1_Xtn ThiF
Other DBs
NCBI-GeneID: 100441438
NCBI-ProteinID: XP_009241125
Ensembl: ENSPPYG00000017619
UniProt: H2PMB2 A0A6D2W5X3
LinkDB
Position
7
AA seq 206 aa
MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV
PFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKM
EDSKEKNGKKKRKSLAKRIRERCCIL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggccgcaaataagcccaagggtcagaattctttggccttacacaaagtcatcatggtg
ggcagtggtggcgtgggcaagtcagctctgactctacagttcatgtacgatgagtttgtg
gaggactatgagcctaccaaagcagacagctatcggaagaaggtagtgctagatggggag
gaagtacagatcgatatcttagatacagctgggcaggaggactacgctgcaataagagac
aactacttccgaagcggggaggggttcctctgtgttttctctattacagaaatggaatcc
tttgcagctacagctgacttcagggagcagattttaagagtaaaagaagatgagaatgtt
ccatttctactggttggtaacaaatcagatttagaagataaaaggcaggtttctgtagaa
gaggcaaaaaacagagctgagcagtggaatgttaactacgtggaaacatctgctaaaaca
cgagctaatgttgacaaggtattttttgatttaatgagagaaattcgagcgagaaagatg
gaagacagcaaagaaaagaatggaaaaaagaagaggaaaagtttagccaagagaatcaga
gaaagatgctgcattttataa

DBGET integrated database retrieval system