KEGG   Pongo abelii (Sumatran orangutan): 100174103
Entry
100174103         CDS       T01416                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04390  Hippo signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100174103 (FGF1)
   04014 Ras signaling pathway
    100174103 (FGF1)
   04015 Rap1 signaling pathway
    100174103 (FGF1)
   04390 Hippo signaling pathway
    100174103 (FGF1)
   04151 PI3K-Akt signaling pathway
    100174103 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100174103 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100174103 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100174103 (FGF1)
   05218 Melanoma
    100174103 (FGF1)
   05224 Breast cancer
    100174103 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100174103 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100174103 (FGF1)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100174103 (FGF1)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100174103 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100174103
NCBI-ProteinID: NP_001127073
UniProt: Q5NVQ3
LinkDB
Position
5
AA seq 214 aa
MHHAATLSPFLQCLPDTGRESGLEGAGISHLLKCWMQPLRFGRSRKLRLESATSSSCWAM
AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQL
SAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKN
WFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 645 nt   +upstreamnt  +downstreamnt
atgcaccatgctgccacattatctccattcctccagtgcctgcctgacactggccgtgaa
tcagggctggaaggggcaggcatttctcatttactaaagtgctggatgcagcccttgagg
ttcggcagaagcagaaagctgcgtcttgaaagcgccacaagcagcagctgctgggccatg
gctgaaggggaaatcaccaccttcacagccctgaccgagaagtttaatctgcctccaggg
aattacaagaagcccaaactcctctactgtagcaacgggggccacttcttgaggatcctt
ccggatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcagctc
agtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttggcc
atggacaccgacgggcttttatacggctcacagacaccaaatgaggaatgtttgttcctg
gaaaggctggaggagaaccattacaacacctatatatccaagaagcatgcagagaagaat
tggtttgttggcctcaagaagaatggaagctgcaaacgcggtcctcggactcactatggc
cagaaagcaatcttgtttctccccctgccagtctcttccgattaa

DBGET integrated database retrieval system