KEGG   Pongo abelii (Sumatran orangutan): 100174114
Entry
100174114         CDS       T01416                                 

Gene name
PKM
Definition
(RefSeq) pyruvate kinase PKM
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00010  Glycolysis / Gluconeogenesis
pon00230  Purine metabolism
pon00620  Pyruvate metabolism
pon01100  Metabolic pathways
pon01200  Carbon metabolism
pon01230  Biosynthesis of amino acids
pon01240  Biosynthesis of cofactors
pon04922  Glucagon signaling pathway
pon04930  Type II diabetes mellitus
pon05165  Human papillomavirus infection
pon05203  Viral carcinogenesis
pon05230  Central carbon metabolism in cancer
Module
pon_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pon_M00002  Glycolysis, core module involving three-carbon compounds
pon_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
pon_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100174114 (PKM)
   00620 Pyruvate metabolism
    100174114 (PKM)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100174114 (PKM)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100174114 (PKM)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100174114 (PKM)
   05230 Central carbon metabolism in cancer
    100174114 (PKM)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100174114 (PKM)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100174114 (PKM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100174114 (PKM)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100174114 (PKM)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     100174114 (PKM)
Membrane trafficking [BR:pon04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100174114 (PKM)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100174114 (PKM)
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI DUF3616
Other DBs
NCBI-GeneID: 100174114
NCBI-ProteinID: NP_001127083
Ensembl: ENSPPYG00000006613
UniProt: Q5NVN0
LinkDB
Position
15
AA seq 531 aa
MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVET
LKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIR
TGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGL
ISLQVKQKGADFLLTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMV
FASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE
IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSGVANAVLDGADCIM
LSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEAS
YKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQE
AWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgtcgaagccacatagtgaagccgggactgcctttattcagacccagcagctgcatgca
gccatggctgacacattcctggagcacatgtgccgcctggacattgattcaccacccatc
acagcccggaacactggcatcatctgtaccattggcccagcttcccgatcagtggagacg
ttgaaggagatgattaagtctggaatgaatgtggctcgtctgaacttctctcatggaact
catgagtaccacgcggagaccatcaagaatgtgcgcacagccacggaaagctttgcttct
gaccccatcctctaccggcccgttgctgtggctctagacactaaaggacctgagatccga
actgggctcatcaagggtagcggcaccgcagaggtggagctgaagaagggagccactctc
aaaatcacactggataacgcctacatggaaaagtgtgacgagaacatcctatggctggac
tacaagaacatctgcaaggtggtggaagtgggcagcaagatctacgtggatgatgggctt
atttctctccaggtgaagcagaaaggtgccgacttcctgttgacggaggtggaaaatggt
ggctccttgggcagcaagaagggtgtgaaccttcctggggctgctgtggacttgcctgct
gtgtcggagaaggacatccaggatctgaagtttggggtcgagcaggatgttgatatggtg
tttgcgtcattcatccgcaaggcatctgatgtccatgaagttaggaaggtcctgggagag
aagggaaagaacatcaagataatcagcaaaatcgagaatcatgagggggttcggaggttt
gatgaaatcctggaggccagtgatgggatcatggtggctcgtggtgatctaggcattgag
attcctgcagagaaggtctttcttgctcagaagatgatgattggacggtgcaaccgagct
gggaagcctgtcatctgtgctactcagatgctggagagcatgatcaagaagccccgcccc
actcgggctgaaggcagtggtgtggccaatgcagtcctggatggagctgactgcatcatg
ctgtctggagaaacagccaaaggggactatcctctggaggctgtgcgcatgcagcacctg
atagctcgtgaggctgaggcagccatgttccaccgcaagctgtttgaagaacttgtgcga
gcctcaagtcactccacagacctcatggaagccatggccatgggcagcgtggaggcttct
tataagtgtttagcagcagctttgatagttctgacggagtctggcaggtctgctcaccag
gtggccagataccgcccacgtgcccccatcattgctgtgacccggaatccccagacagct
cgtcaggcccacctgtaccgtggcatcttccctgtgctgtgcaaggacccagtccaggag
gcctgggctgaggacgtggacctccgcgtgaactttgccatgaatgttggcaaggcccga
ggcttcttcaagaagggagatgtggtcattgtgctgaccggatggcgccctggctccggc
ttcaccaacaccatgcgtgttgttcctgtgccgtga

DBGET integrated database retrieval system