KEGG   Pongo abelii (Sumatran orangutan): 100174239
Entry
100174239         CDS       T01416                                 

Gene name
HOXD10
Definition
(RefSeq) homeobox protein Hox-D10
  KO
K09295  homrobox protein Hox-D10
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100174239 (HOXD10)
   05205 Proteoglycans in cancer
    100174239 (HOXD10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100174239 (HOXD10)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    100174239 (HOXD10)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 100174239
NCBI-ProteinID: NP_001127185
Ensembl: ENSPPYG00000012958
UniProt: Q5REX7
LinkDB
Position
2B
AA seq 340 aa
MSFPNSSPAANTFLVDSLIGACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKR
EVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKR
NKLISSEVPSYQRLVPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNSPGGSSTVMLQL
NPRGAAKPQLSAAQLQMEKKMNESVSGQEPTKVSQVESPEAKGGLPEERSCLAEVSVSSP
EVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEVS
KSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTLS
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtcctttcccaacagctctcctgctgctaatacttttttagtagattccttgatcggt
gcctgcaggagtgacagtttttattccagcagcgccagcatgtacatgccaccacctagc
gcagacatggggacctatggaatgcaaacctgtggactgctcccgtctctggccaaaaga
gaagtgaaccaccaaaatatgggtatgaatgtgcatccttatatacctcaagtagacagt
tggacagatccgaacagatcttgtcgaatagagcaacctgttacacagcaagtccccact
tgctccttcaccaccaacattaaggaagaatccaattgctgcatgtattctgataagcgc
aacaaactcatttcgtccgaggtcccttcgtaccagaggctggtccctgagtcttgtccc
gttgagaaccctgaggttcccgtccctggatattttagactgagtcagacctacgccacc
gggaaaacccaagagtacaataacagccccggaggcagctccactgtcatgctccagctc
aaccctcgtggcgcggccaagccgcagctctccgctgcccagctgcagatggaaaagaag
atgaacgagtccgtgagcggccaggagcccaccaaagtctcccaggtggagagccccgag
gccaaaggcggccttcccgaagagaggagctgcctggctgaggtctccgtgtccagtccc
gaagtgcaggagaaggaaagcaaagaggaaatcaagtctgatacaccaaccagcaattgg
ctcactgcaaagagtggcagaaagaagaggtgcccttacactaagcaccaaacgctggaa
ttagaaaaagagttcttgttcaatatgtacctcacccgcgagcgccgcctagaggtcagt
aagagcgttaacctcaccgacaggcaggtgaagatttggtttcaaaaccgccgaatgaaa
ctcaagaagatgagccgagagaaccggatccgagaactgaccgccaacctcacgctttct
tag

DBGET integrated database retrieval system