KEGG   Pongo abelii (Sumatran orangutan): 100174439
Entry
100174439         CDS       T01416                                 

Gene name
CDH1
Definition
(RefSeq) cadherin-1 precursor
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04371  Apelin signaling pathway
pon04390  Hippo signaling pathway
pon04514  Cell adhesion molecules
pon04520  Adherens junction
pon05100  Bacterial invasion of epithelial cells
pon05200  Pathways in cancer
pon05213  Endometrial cancer
pon05216  Thyroid cancer
pon05218  Melanoma
pon05219  Bladder cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100174439 (CDH1)
   04390 Hippo signaling pathway
    100174439 (CDH1)
   04371 Apelin signaling pathway
    100174439 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100174439 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100174439 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100174439 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100174439 (CDH1)
   05216 Thyroid cancer
    100174439 (CDH1)
   05218 Melanoma
    100174439 (CDH1)
   05219 Bladder cancer
    100174439 (CDH1)
   05213 Endometrial cancer
    100174439 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100174439 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100174439 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pon04515]
    100174439 (CDH1)
   04090 CD molecules [BR:pon04090]
    100174439 (CDH1)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100174439 (CDH1)
Cell adhesion molecules [BR:pon04515]
 Cadherins
  Major cadherins
   100174439 (CDH1)
CD molecules [BR:pon04090]
 Proteins
  100174439 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro RET_CLD1 Cadherin_3 Phage_holin_5_2
Other DBs
NCBI-GeneID: 100174439
NCBI-ProteinID: NP_001127374
Ensembl: ENSPPYG00000007494
UniProt: Q5RAX1
LinkDB
Position
16
AA seq 882 aa
MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDC
TGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVG
HHHRPLPHQASVSGIQAELLTFPNSSSGLRRRKRDWVIPPISCPENEKGPFPKNLVQIKS
NKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGN
AVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI
AYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTAT
AVITVTDTNDNPPVFNPTTYKGQVPEDEANVVITTLKVTDADAPSTPAWEAVYTILNDNG
GQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV
NEAPIFVPPEKRVEVSEDFGVGQEITSYTAWEPDTFMEQKITYRIWRDTANWLEINPDTG
AISTRAELDREDVEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTL
FFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEV
GDYKINLKLMDNQNKDQVTTLEVGVCDCEGVAGVCKKAQPIEAGLQIPAILGILGGILAL
LILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARP
EVTRNDVAPTLMSVPRYLPRPANPVEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGS
EAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2649 nt   +upstreamnt  +downstreamnt
atgggcccttggagccgcagtctctcggcgctgctgctgctgctgcaggtctcctcttgg
ctctgccaggagccggagccctgccaccccggctttgacgccgagagctacacgttcacg
gtgccccggcgccacctggagagaggccgcgtcctgggcagagtgaattttgaagattgc
acgggtcgacaaaggacagcctatttttccctcgacacccgattcaaagtgggcacagat
ggtgtgattacagtcaaaaggcctctacggtttcataacccacagatccatttcttggtc
tacgcctgggactccacctacagaaagttttccaccaaagtcacgctgaatacagtgggg
caccaccaccgccccctgccgcatcaggcctctgtttctggaatccaagcagaattgctc
acatttcccaactcctcttctggcctcagaagacggaagagagactgggttattcctccc
ataagctgcccagaaaatgaaaaaggcccgtttcctaaaaacctggttcagatcaaatcc
aacaaagacaaagaaggcaaggttttctacagcatcactggccaaggagctgacacgccc
cctgttggtgtctttattattgaaagagaaacaggatggctgaaggtgacagagcctctg
gatagagaacgcattgccacatacactctcttctctcatgctgtgtcatccaacgggaac
gcagttgaggacccaatggagattttgatcacagtgaccgatcagaatgacaacaagccc
gaattcacccaggaggtctttaaggggtctgtcatggaaggtgctcttccaggaacctct
gtgatggaggtcacagccacagacgcggacgatgatgtgaacacctacaatgctgccatc
gcttacaccatcctcagccaagatcctgagctgcctgacaaaaatatgttcaccattaac
aggaacacaggagtcatcagtgtggtcaccactgggctggaccgagagagtttccctaca
tataccctggtggttcaggctgctgaccttcaaggtgaggggttaagcacaacagcgaca
gctgtgatcacagtcacggacaccaacgataaccctccggtcttcaatcccaccacgtac
aagggtcaggtgcctgaggacgaggctaacgtcgtaatcaccacactgaaagtgactgat
gctgatgcccccagtaccccagcatgggaggctgtatacaccatattgaatgataatggt
ggacaatttgtcgtcaccacaaatccagtgaacaacgatggcattttgaaaacagcaaag
ggcttggattttgaggccaagcagcagtacattctacacgtagcagtgacgaatgtagtg
ccttttgaggtctctctcaccacctccacagccactgtcaccgtggatgtgctggatgtg
aatgaagcccccatctttgtgcctcctgaaaagagagtggaagtgtccgaggactttggc
gtgggccaggaaatcacatcctacactgcctgggaaccagacacatttatggaacagaaa
ataacgtatcggatttggagagacactgccaactggctggagattaatccggacactggt
gccatttccactcgggctgagctggatagggaggatgttgagcacgtgaagaacagcaca
tacacagccctcatcatagctacagacaacggttctccagttgctactggaacagggaca
cttctgctgatcctgtctgatgtgaatgacaatgcccccataccagaacctcgaactcta
ttcttctgtgagaggaatccaaagcctcaggtcataaacatcattgatgcagaccttcct
cccaatacatcccccttcacagcagaactaacacacggggcgagtgccaactggaccatt
cagtacaacgacccaacccaagaatctatcattttgaagccgaagatggccttagaggtg
ggtgactacaaaatcaatctcaagctcatggataaccagaataaagaccaagtgaccacc
ttagaggtcggcgtgtgtgactgtgaaggggtcgccggcgtctgtaagaaggcacagcct
atcgaagcaggattgcaaattcctgccattctggggattcttggaggaattcttgctttg
ctaattctgattctgctgctcctgctgtttcttcggaggagagcggtggtcaaagagccc
ttactgcccccagaggatgacacccgggacaacgtttattactatgacgaagaaggaggc
ggagaagaggaccaggactttgacttgagccagttgcacaggggcctggacgctcggcct
gaagtgactcgtaatgatgtcgcgccaacactcatgagtgtcccccggtaccttccccgc
cctgccaatcccgttgaaattggaaattttattgatgaaaacctgaaggcggctgatact
gaccccacagccccgccttatgattctctgctcgtgtttgactatgaaggaagcggttcc
gaagctgctagtctgagctccctgaactcctcagagtcagacaaagaccaggactatgac
tacttgaacgaatggggcaatcgcttcaagaagctggcagacatgtacggaggcggcgag
gacgactag

DBGET integrated database retrieval system