KEGG   Pongo abelii (Sumatran orangutan): 100174482
Entry
100174482         CDS       T01416                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04024  cAMP signaling pathway
pon04068  FoxO signaling pathway
pon04071  Sphingolipid signaling pathway
pon04137  Mitophagy - animal
pon04140  Autophagy - animal
pon04141  Protein processing in endoplasmic reticulum
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04217  Necroptosis
pon04310  Wnt signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04530  Tight junction
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04668  TNF signaling pathway
pon04722  Neurotrophin signaling pathway
pon04723  Retrograde endocannabinoid signaling
pon04728  Dopaminergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04910  Insulin signaling pathway
pon04912  GnRH signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04917  Prolactin signaling pathway
pon04920  Adipocytokine signaling pathway
pon04926  Relaxin signaling pathway
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05133  Pertussis
pon05135  Yersinia infection
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05162  Measles
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05231  Choline metabolism in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100174482 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100174482 (MAPK10)
   04012 ErbB signaling pathway
    100174482 (MAPK10)
   04014 Ras signaling pathway
    100174482 (MAPK10)
   04310 Wnt signaling pathway
    100174482 (MAPK10)
   04668 TNF signaling pathway
    100174482 (MAPK10)
   04068 FoxO signaling pathway
    100174482 (MAPK10)
   04071 Sphingolipid signaling pathway
    100174482 (MAPK10)
   04024 cAMP signaling pathway
    100174482 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100174482 (MAPK10)
   04137 Mitophagy - animal
    100174482 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    100174482 (MAPK10)
   04215 Apoptosis - multiple species
    100174482 (MAPK10)
   04217 Necroptosis
    100174482 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100174482 (MAPK10)
   04530 Tight junction
    100174482 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100174482 (MAPK10)
   04621 NOD-like receptor signaling pathway
    100174482 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    100174482 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    100174482 (MAPK10)
   04660 T cell receptor signaling pathway
    100174482 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    100174482 (MAPK10)
   04659 Th17 cell differentiation
    100174482 (MAPK10)
   04657 IL-17 signaling pathway
    100174482 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    100174482 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100174482 (MAPK10)
   04920 Adipocytokine signaling pathway
    100174482 (MAPK10)
   04912 GnRH signaling pathway
    100174482 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    100174482 (MAPK10)
   04917 Prolactin signaling pathway
    100174482 (MAPK10)
   04926 Relaxin signaling pathway
    100174482 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    100174482 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    100174482 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    100174482 (MAPK10)
   04722 Neurotrophin signaling pathway
    100174482 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100174482 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100174482 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100174482 (MAPK10)
   05231 Choline metabolism in cancer
    100174482 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100174482 (MAPK10)
   05212 Pancreatic cancer
    100174482 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100174482 (MAPK10)
   05012 Parkinson disease
    100174482 (MAPK10)
   05016 Huntington disease
    100174482 (MAPK10)
   05017 Spinocerebellar ataxia
    100174482 (MAPK10)
   05020 Prion disease
    100174482 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    100174482 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100174482 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100174482 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    100174482 (MAPK10)
   04931 Insulin resistance
    100174482 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100174482 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100174482 (MAPK10)
   05135 Yersinia infection
    100174482 (MAPK10)
   05133 Pertussis
    100174482 (MAPK10)
   05152 Tuberculosis
    100174482 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100174482 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    100174482 (MAPK10)
   05161 Hepatitis B
    100174482 (MAPK10)
   05171 Coronavirus disease - COVID-19
    100174482 (MAPK10)
   05162 Measles
    100174482 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100174482 (MAPK10)
   05169 Epstein-Barr virus infection
    100174482 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100174482 (MAPK10)
   05142 Chagas disease
    100174482 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100174482 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100174482 (MAPK10)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100174482 (MAPK10)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100174482 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 100174482
NCBI-ProteinID: NP_001127412
UniProt: Q5RA26
LinkDB
Position
4
AA seq 384 aa
MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRP
FQHQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEGFQDVYLVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSK
MLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDEQLDEREHTIDEWKELIYKEV
MNSEEKTKNGVVKGQPSPSAQVQQ
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgagcaaaagcaaagttgacaaccagttctacagtgtggaagtgggagactcaaccttc
acagttctcaagcgctaccagaatctaaagcctattggctctggggctcagggcatagtt
tgtgccgcgtatgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccc
tttcagcaccaaacacatgccaagagagcgtaccgggagctggtcctcatgaagtgtgtg
aaccataaaaacattattagtttattaaatgtcttcacaccccagaaaacgctggagggg
ttccaagatgtttacttggtaatggaactgatggatgccaacttatgtcaagtgattcag
atggaattagaccacgagcgaatgtcttacctgctgtaccaaatgttgtgtggcattaag
cacctccattctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaag
tctgattgcacattgaaaatcctggactttggactggccaggacagcaggcacaagcttc
atgatgactccatatgtggtgacacgttattacagagcccctgaggtcatcctggggatg
ggctacaaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgc
cacaaaatcctctttccaggaagggactatattgaccagtggaataaggtaattgaacaa
ctaggaacaccatgtccagaattcatgaagaaattgcaacccacagtaagaaactatgtg
gagaatcggcccaagtatgcaggactcaccttccccaagctcttcccagattccctcttc
ccagcggactccgagcacaataaactcaaagccagccaagccagggacttgttgtcaaag
atgctagtgattgacccagcaaaaagaatatcagtggacgatgccttacagcatccctac
atcaacgtctggtatgacccagccgaagtggaggcgcctccacctcagatatatgacgag
cagttggatgaaagagaacacacaatcgatgaatggaaagaacttatctacaaggaagta
atgaactcagaagaaaagactaaaaatggcgtagtaaaaggacagccttctccttcagca
caggtgcagcagtga

KEGG   Pongo abelii (Sumatran orangutan): 100437424
Entry
100437424         CDS       T01416                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04024  cAMP signaling pathway
pon04068  FoxO signaling pathway
pon04071  Sphingolipid signaling pathway
pon04137  Mitophagy - animal
pon04140  Autophagy - animal
pon04141  Protein processing in endoplasmic reticulum
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04217  Necroptosis
pon04310  Wnt signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04530  Tight junction
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04668  TNF signaling pathway
pon04722  Neurotrophin signaling pathway
pon04723  Retrograde endocannabinoid signaling
pon04728  Dopaminergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04910  Insulin signaling pathway
pon04912  GnRH signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04917  Prolactin signaling pathway
pon04920  Adipocytokine signaling pathway
pon04926  Relaxin signaling pathway
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05133  Pertussis
pon05135  Yersinia infection
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05162  Measles
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05231  Choline metabolism in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100437424 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100437424 (MAPK8)
   04012 ErbB signaling pathway
    100437424 (MAPK8)
   04014 Ras signaling pathway
    100437424 (MAPK8)
   04310 Wnt signaling pathway
    100437424 (MAPK8)
   04668 TNF signaling pathway
    100437424 (MAPK8)
   04068 FoxO signaling pathway
    100437424 (MAPK8)
   04071 Sphingolipid signaling pathway
    100437424 (MAPK8)
   04024 cAMP signaling pathway
    100437424 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100437424 (MAPK8)
   04137 Mitophagy - animal
    100437424 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    100437424 (MAPK8)
   04215 Apoptosis - multiple species
    100437424 (MAPK8)
   04217 Necroptosis
    100437424 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100437424 (MAPK8)
   04530 Tight junction
    100437424 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100437424 (MAPK8)
   04621 NOD-like receptor signaling pathway
    100437424 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    100437424 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    100437424 (MAPK8)
   04660 T cell receptor signaling pathway
    100437424 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    100437424 (MAPK8)
   04659 Th17 cell differentiation
    100437424 (MAPK8)
   04657 IL-17 signaling pathway
    100437424 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    100437424 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100437424 (MAPK8)
   04920 Adipocytokine signaling pathway
    100437424 (MAPK8)
   04912 GnRH signaling pathway
    100437424 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    100437424 (MAPK8)
   04917 Prolactin signaling pathway
    100437424 (MAPK8)
   04926 Relaxin signaling pathway
    100437424 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    100437424 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    100437424 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    100437424 (MAPK8)
   04722 Neurotrophin signaling pathway
    100437424 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100437424 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100437424 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100437424 (MAPK8)
   05231 Choline metabolism in cancer
    100437424 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100437424 (MAPK8)
   05212 Pancreatic cancer
    100437424 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100437424 (MAPK8)
   05012 Parkinson disease
    100437424 (MAPK8)
   05016 Huntington disease
    100437424 (MAPK8)
   05017 Spinocerebellar ataxia
    100437424 (MAPK8)
   05020 Prion disease
    100437424 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    100437424 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100437424 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100437424 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    100437424 (MAPK8)
   04931 Insulin resistance
    100437424 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100437424 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100437424 (MAPK8)
   05135 Yersinia infection
    100437424 (MAPK8)
   05133 Pertussis
    100437424 (MAPK8)
   05152 Tuberculosis
    100437424 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100437424 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    100437424 (MAPK8)
   05161 Hepatitis B
    100437424 (MAPK8)
   05171 Coronavirus disease - COVID-19
    100437424 (MAPK8)
   05162 Measles
    100437424 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100437424 (MAPK8)
   05169 Epstein-Barr virus infection
    100437424 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100437424 (MAPK8)
   05142 Chagas disease
    100437424 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100437424 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100437424 (MAPK8)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100437424 (MAPK8)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100437424 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 100437424
NCBI-ProteinID: XP_002820749
Ensembl: ENSPPYG00000002246
UniProt: A0A2J8RSY1
LinkDB
Position
10
AA seq 427 aa
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacaacaatttttatagtgtagagattggagattctacattc
acagtcctgaaacgatatcagaatttaaaacctataggctcaggagctcaaggaatagta
tgtgcagcttatgatgccattctcgaaagaaatgttgcaatcaagaagctaagccgacca
tttcagaatcagactcatgccaagcgggcctacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggagctagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcattctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tctgactgcactttgaagattcttgacttcggtctggccaggactgcaggaacgagtttt
atgatgacgccttacgtagtgactcgctactacagagcacccgaggtcatcctcggcatg
ggctacaaggaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactgcaaccaacagtaaggacttacgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtccttttc
ccagctgactcggaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaatagatgcatctaaaaggatctctgtagatgaagctctccaacacccgtac
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatccctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatataaggaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcgtcgtctgtcaatgatgtgtcc
tcaatgtcaacagatccgactttggcctcggatacagacagcagtctagaagcatcagct
gggcctctgggctgctgtagatga

KEGG   Pongo abelii (Sumatran orangutan): 100459133
Entry
100459133         CDS       T01416                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04024  cAMP signaling pathway
pon04068  FoxO signaling pathway
pon04071  Sphingolipid signaling pathway
pon04137  Mitophagy - animal
pon04140  Autophagy - animal
pon04141  Protein processing in endoplasmic reticulum
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04217  Necroptosis
pon04310  Wnt signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04530  Tight junction
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04668  TNF signaling pathway
pon04722  Neurotrophin signaling pathway
pon04723  Retrograde endocannabinoid signaling
pon04728  Dopaminergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04910  Insulin signaling pathway
pon04912  GnRH signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04917  Prolactin signaling pathway
pon04920  Adipocytokine signaling pathway
pon04926  Relaxin signaling pathway
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05133  Pertussis
pon05135  Yersinia infection
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05162  Measles
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05231  Choline metabolism in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100459133 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100459133 (MAPK9)
   04012 ErbB signaling pathway
    100459133 (MAPK9)
   04014 Ras signaling pathway
    100459133 (MAPK9)
   04310 Wnt signaling pathway
    100459133 (MAPK9)
   04668 TNF signaling pathway
    100459133 (MAPK9)
   04068 FoxO signaling pathway
    100459133 (MAPK9)
   04071 Sphingolipid signaling pathway
    100459133 (MAPK9)
   04024 cAMP signaling pathway
    100459133 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100459133 (MAPK9)
   04137 Mitophagy - animal
    100459133 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    100459133 (MAPK9)
   04215 Apoptosis - multiple species
    100459133 (MAPK9)
   04217 Necroptosis
    100459133 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100459133 (MAPK9)
   04530 Tight junction
    100459133 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100459133 (MAPK9)
   04621 NOD-like receptor signaling pathway
    100459133 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    100459133 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    100459133 (MAPK9)
   04660 T cell receptor signaling pathway
    100459133 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    100459133 (MAPK9)
   04659 Th17 cell differentiation
    100459133 (MAPK9)
   04657 IL-17 signaling pathway
    100459133 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    100459133 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100459133 (MAPK9)
   04920 Adipocytokine signaling pathway
    100459133 (MAPK9)
   04912 GnRH signaling pathway
    100459133 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    100459133 (MAPK9)
   04917 Prolactin signaling pathway
    100459133 (MAPK9)
   04926 Relaxin signaling pathway
    100459133 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    100459133 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    100459133 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    100459133 (MAPK9)
   04722 Neurotrophin signaling pathway
    100459133 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100459133 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100459133 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459133 (MAPK9)
   05231 Choline metabolism in cancer
    100459133 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100459133 (MAPK9)
   05212 Pancreatic cancer
    100459133 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100459133 (MAPK9)
   05012 Parkinson disease
    100459133 (MAPK9)
   05016 Huntington disease
    100459133 (MAPK9)
   05017 Spinocerebellar ataxia
    100459133 (MAPK9)
   05020 Prion disease
    100459133 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    100459133 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100459133 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100459133 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    100459133 (MAPK9)
   04931 Insulin resistance
    100459133 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100459133 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100459133 (MAPK9)
   05135 Yersinia infection
    100459133 (MAPK9)
   05133 Pertussis
    100459133 (MAPK9)
   05152 Tuberculosis
    100459133 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100459133 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    100459133 (MAPK9)
   05161 Hepatitis B
    100459133 (MAPK9)
   05171 Coronavirus disease - COVID-19
    100459133 (MAPK9)
   05162 Measles
    100459133 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100459133 (MAPK9)
   05169 Epstein-Barr virus infection
    100459133 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100459133 (MAPK9)
   05142 Chagas disease
    100459133 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100459133 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100459133 (MAPK9)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100459133 (MAPK9)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100459133 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 100459133
NCBI-ProteinID: XP_009239649
Ensembl: ENSPPYG00000016135
UniProt: H2PHM5 A0A663DHG9
LinkDB
Position
5
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCSLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagcgacagtaaatgtgacagtcagttttacagtgtgcaagtggcagactcaaccttc
actgtcctaaaacgttaccagcagctgaaaccaattggctctggggcccaagggattgtt
tgtgctgcatttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaaccaaactcatgcaaagagagcttatcgtgaactcgtcctcttaaaatgtgtc
aatcataaaaatataattagtttgttaaatgtgtttacaccacaaaaaactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcat
atggagctggatcatgaaagaatgtcctaccttctttaccagatgctttgtggtattaaa
catctgcattcagctggtataattcatagagatttgaagcctagcaacattgttgtgaaa
tcggactgcagcctgaagatccttgactttggcctggcccggacagcatgcactaacttc
atgatgaccccttacgtggtgacacggtactaccgggcgcccgaagtcatcctgggcatg
ggctacaaagagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgaccatattgatcagtggaataaagttattgagcag
cttggaacaccatcagcagagttcatgaagaaacttcagccaactgtgaggaattatgtc
gaaaacagaccaaagtatcctggaatcaaattcgaagaactctttccagattggatattc
ccatcagaatctgagcgagacaaaataaaaacaagtcaagccagagatctgttatcaaaa
atgttagtgattgatcctgacaagcggatctctgtagacgaagctctgcgtcacccatac
atcactgtttggtatgaccccgctgaagcagaagccccaccacctcaaatttatgatgcc
cagttggaagaaagagaacatgcaattgaagaatggaaagagctaatttacaaagaagtc
atggattgggaagaaagaagcaagaatggtgttgtaaaagatcagccttcagatgcagca
gtaagtagcaacgccactccttctcagtcttcatctatcaatgacatttcatccatgtcc
actgagcagacgctggcctcagacacagacagcagtcttgatgcctcgacgggacccctt
gaaggctgtcgatga

DBGET integrated database retrieval system