KEGG   Pongo abelii (Sumatran orangutan): 100174613
Entry
100174613         CDS       T01416                                 

Gene name
PTK2B
Definition
(RefSeq) protein-tyrosine kinase 2-beta
  KO
K05871  focal adhesion kinase 2 [EC:2.7.10.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04062  Chemokine signaling pathway
pon04072  Phospholipase D signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04670  Leukocyte transendothelial migration
pon04912  GnRH signaling pathway
pon05135  Yersinia infection
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100174613 (PTK2B)
   04072 Phospholipase D signaling pathway
    100174613 (PTK2B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100174613 (PTK2B)
   04670 Leukocyte transendothelial migration
    100174613 (PTK2B)
   04062 Chemokine signaling pathway
    100174613 (PTK2B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100174613 (PTK2B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100174613 (PTK2B)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100174613 (PTK2B)
   05161 Hepatitis B
    100174613 (PTK2B)
   05163 Human cytomegalovirus infection
    100174613 (PTK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100174613 (PTK2B)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100174613 (PTK2B)
Protein kinases [BR:pon01001]
 Non-receptor tyrosine kinases
  FAK family
   100174613 (PTK2B)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT FERM_N_2 Pkinase FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 100174613
NCBI-ProteinID: NP_001127536
Ensembl: ENSPPYG00000018462
UniProt: Q5R7F6
LinkDB
Position
8
AA seq 1009 aa
MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIREIITSILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQG
SLIIHPRKDGEKRNSLPQIPMLNLEARRSLLSESCSIESDIYAEIPDETLRRTGGPQYGI
AREDVVLNRILGEGFFGEVYEGLYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLFPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDVYQMEKDIVMEQERNARYRTPKILEPTTFQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIRPSSREEAQQLWEAEKIKMRQILDKQQKQMVEDYQWLKQEEKSLDPMVYMNDKSP
LTPEKEVGYMEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
NT seq 3030 nt   +upstreamnt  +downstreamnt
atgtctggggtgtctgagcccctgagccgagtaaagttgggcacattacgccggcctgaa
ggccctgcagagcccatggtggtggtaccagtagatgtggaaaaggaagacgtgcgtatc
ctcaaggtctgcttctatagcaacagcttcaatcctgggaagaacttcaaactggtcaaa
tgcactgtccagacggagatccgggagatcatcacctccatcctgctgagcgggcggatc
gggcccaacatccagttggctgagtgctatgggctaaggctgaagcacatgaagtccgat
gagatccactggctgcacccacagatgacggtgggtgaggtgcaggacaagtatgagtgt
ctgcacgtggaagccgagtggaggtatgaccttcaaatacgctacttgccggaagacttc
atggaaagcctgaaggaggacaggaccacactgctctatttttaccaacagctccggaac
gactacatgcagcgctatgccagcaaggtcagcgagggcatggccctgcagctgggctgc
ctggagctcaggcggttcttcaaggatatgccccacaatgcacttgacaagaagtccaac
ttcgagctcctagaaaaggaagtggggctggacttgtttttcccaaagcagatgcaggag
aacttaaagcccaaacagttccggaagatgatccagcagaccttccagcagtacgcctcg
ctcagggaggaggagtgcgtcatgaagttcttcaacactctcgcgggcttcgccaacatc
gaccaggagacctaccgctgcgaactcattcaaggatggaacatcactgtggacctggtc
attggccctaaagggatccgccagctgactagtcaggacgcaaagcccacctgcctggcc
gagttcaagcagatcaggtccatcaggtgcctcccactggaggagggccaggcagtactt
cagctgggcattgaaggtgccccccaggccttgtccatcaaaacctcgtccctagcagag
gctgagaacatggctgacctcatagacggctactgccggctgcagggggaacaccaaggc
tctctcatcatccatcctaggaaagatggtgagaagcggaacagcctgccccagatcccc
atgctaaacctggaggcccggcggtccctcctctcagagagctgcagcatagagtcagac
atctacgcagagattcctgatgaaaccctgcgaaggactggaggtccacagtatggcatt
gcccgtgaagatgtggtcctgaatcgtattcttggggaaggcttttttggggaggtctat
gaaggtctctacacaaatcacaaaggggagaaaatcaatgtagctgtcaagacctgcaag
aaagactgcactctggacaacaaggagaagttcatgagcgaggcagtgatcatgaagaac
ctcgaccacccgcacatcgtgaagctgattggcatcattgaagaggagcccacctggatc
atcatggaattgtatccctacggggagctgggccactacctggagcggaacaagaactcc
ctgaaggtgctcaccctcgtgctgtactcactgcagatatgcaaagccatggcctacctg
gagagcatcaactgcgtgcacagggacattgctgtccggaacatcctggtggcctcccct
gagtgtgtgaagctgggggactttggtctttcccggtacattgaggacgaggactattac
aaagcctctgtgactcgtctccccatcaaatggatgtccccagagtccattaacttccga
cgcttcacgacagccagtgacgtctggatgttcgctgtgtgcatgtgggagatcctgagc
tttgggaagcagcccttcttctggctggagaacaaggatgtcatcggggtgctggagaaa
ggggaccggctgcccaagcctgacctctttccaccggtcctttataccctcatgacccgc
tgctgggactacgaccccagtgaccggccccgcttcaccgagctggtgtgcagcctcagt
gacgtttatcagatggagaaagacattgtcatggagcaagagaggaatgctcgctaccga
acccccaaaatcttggagcccacaaccttccaggaacccccacccaagcccagccgacct
aagtacagaccccctccacaaaccaacctcctggctccaaaactacagttccaggttccc
gagggtctgtgtgccagctctcctacactcaccagccctatggagtatccatctcccgtt
aactcactgcacaccccacctctccaccggcacaatgtcttcaaacgccacagcatgcgg
gaggaggatttcatccgacccagcagccgagaagaggcccagcagctgtgggaggctgaa
aagatcaaaatgcggcaaatcctggacaaacagcagaagcagatggtggaggactaccag
tggctcaagcaggaggagaagtccctggaccccatggtttatatgaatgataagtcccca
ttgacgccagagaaggaggtcggctacatggagttcaccgggcctccacagaagcccccg
aggctgggcgcacagtccatccagcccacagctaacctggaccggaccgatgacttggtg
tacctcaatgtcatggagctggtgcgggccgtgctggagctcaagaatgagctctgtcag
ctgccccccgagggctacgtggtggtggtgaagaatgtggggctgaccctgcggaagctc
atcgggagcgtggacgatctcctgccttccttgccgtcgtcttcacggacagagatcgag
ggcacccagaaactgctcaacaaagacctagcagagctcatcaacaagatgcggctggcg
cagcagaacgccgtgacttccctgagtgaggagtgcaagaggcagatgctgacggcttca
cacaccctggccgtggacgccaagaacctgctcgacgctgtggaccaggccaaggttctg
gccaatctggcccacccacctgcagagtga

DBGET integrated database retrieval system