KEGG   Pongo abelii (Sumatran orangutan): 100174748
Entry
100174748         CDS       T01416                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform 2
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04020  Calcium signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04114  Oocyte meiosis
pon04140  Autophagy - animal
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04310  Wnt signaling pathway
pon04340  Hedgehog signaling pathway
pon04371  Apelin signaling pathway
pon04530  Tight junction
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04714  Thermogenesis
pon04720  Long-term potentiation
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04740  Olfactory transduction
pon04742  Taste transduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04910  Insulin signaling pathway
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04919  Thyroid hormone signaling pathway
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04961  Endocrine and other factor-regulated calcium reabsorption
pon04962  Vasopressin-regulated water reabsorption
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04976  Bile secretion
pon05012  Parkinson disease
pon05020  Prion disease
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05032  Morphine addiction
pon05034  Alcoholism
pon05146  Amoebiasis
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100174748 (PRKACB)
   04014 Ras signaling pathway
    100174748 (PRKACB)
   04310 Wnt signaling pathway
    100174748 (PRKACB)
   04340 Hedgehog signaling pathway
    100174748 (PRKACB)
   04371 Apelin signaling pathway
    100174748 (PRKACB)
   04020 Calcium signaling pathway
    100174748 (PRKACB)
   04024 cAMP signaling pathway
    100174748 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100174748 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100174748 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100174748 (PRKACB)
   04540 Gap junction
    100174748 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100174748 (PRKACB)
   04062 Chemokine signaling pathway
    100174748 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    100174748 (PRKACB)
   04910 Insulin signaling pathway
    100174748 (PRKACB)
   04922 Glucagon signaling pathway
    100174748 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    100174748 (PRKACB)
   04912 GnRH signaling pathway
    100174748 (PRKACB)
   04913 Ovarian steroidogenesis
    100174748 (PRKACB)
   04915 Estrogen signaling pathway
    100174748 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    100174748 (PRKACB)
   04921 Oxytocin signaling pathway
    100174748 (PRKACB)
   04926 Relaxin signaling pathway
    100174748 (PRKACB)
   04935 Growth hormone synthesis, secretion and action
    100174748 (PRKACB)
   04918 Thyroid hormone synthesis
    100174748 (PRKACB)
   04919 Thyroid hormone signaling pathway
    100174748 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    100174748 (PRKACB)
   04916 Melanogenesis
    100174748 (PRKACB)
   04924 Renin secretion
    100174748 (PRKACB)
   04925 Aldosterone synthesis and secretion
    100174748 (PRKACB)
   04927 Cortisol synthesis and secretion
    100174748 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100174748 (PRKACB)
   04270 Vascular smooth muscle contraction
    100174748 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    100174748 (PRKACB)
   04971 Gastric acid secretion
    100174748 (PRKACB)
   04976 Bile secretion
    100174748 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100174748 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100174748 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    100174748 (PRKACB)
   04727 GABAergic synapse
    100174748 (PRKACB)
   04725 Cholinergic synapse
    100174748 (PRKACB)
   04728 Dopaminergic synapse
    100174748 (PRKACB)
   04726 Serotonergic synapse
    100174748 (PRKACB)
   04720 Long-term potentiation
    100174748 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    100174748 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    100174748 (PRKACB)
   04742 Taste transduction
    100174748 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    100174748 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    100174748 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    100174748 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100174748 (PRKACB)
   04714 Thermogenesis
    100174748 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100174748 (PRKACB)
   05205 Proteoglycans in cancer
    100174748 (PRKACB)
   05203 Viral carcinogenesis
    100174748 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100174748 (PRKACB)
   05020 Prion disease
    100174748 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    100174748 (PRKACB)
   05031 Amphetamine addiction
    100174748 (PRKACB)
   05032 Morphine addiction
    100174748 (PRKACB)
   05034 Alcoholism
    100174748 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100174748 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100174748 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100174748 (PRKACB)
   05163 Human cytomegalovirus infection
    100174748 (PRKACB)
   05165 Human papillomavirus infection
    100174748 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100174748 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100174748 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100174748 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100174748 (PRKACB)
   03036 Chromosome and associated proteins [BR:pon03036]
    100174748 (PRKACB)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100174748 (PRKACB)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  PKA family
   100174748 (PRKACB)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100174748 (PRKACB)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100174748 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 100174748
NCBI-ProteinID: NP_001127665
Ensembl: ENSPPYG00000001209
UniProt: Q5R472
LinkDB
Position
1
AA seq 354 aa
MSARKSSDASACSSSEISVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGR
VMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNL
YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDH
QGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYP
PFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKW
FATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagtgcacgcaaatcatcagatgcatctgcttgctcctcttcagaaatatctgtgaaa
gagtttctagccaaagccaaagaagactttttgaaaaaatgggagaatccaactcagaat
aatgccggacttgaagattttgaaaggaaaaaaacccttggaacaggttcatttggaaga
gtcatgttggtaaaacacaaagccactgaacagtattatgccatgaagatcttagataag
cagaaggttgttaaactgaagcaaatagagcatactttgaatgagaaaagaatattacag
gcagtgaattttcctttccttgttcgactggagtatgcttttaaggataattctaattta
tacatggttatggaatatgtccctgggggtgaaatgttttcacatctaagacgaattgga
aggttcagtgagccccatgcaaggttctatgcagctcagatagtgctaacattcgagtac
ctccattcactagacctcatctacagagatctaaaacctgaaaatctcttaattgaccat
caaggctatatccaggtcacagactttgggtttgccaaaagagttaaaggcagaacttgg
acattatgtggaactccagagtatttggctccagaaataattctcagcaagggctacaat
aaggcagtggattggtgggcattaggagtgctaatctatgaaatggcagctggctatccc
ccattctttgcagaccaaccaattcagatttatgaaaagattgtttctggaaaggtccga
ttcccatcccacttcagttcagatctcaaggaccttctacggaacctgctgcaggtggat
ttgaccaagagatttggaaatctaaagaatggtgtcagtgatataaaaactcacaagtgg
tttgccacgacagattggattgctatttaccagaggaaggttgaagctccattcatacca
aagtttagaggctctggagataccagcaactttgatgactatgaagaagaagatatccgt
gtctctataacagaaaaatgtgcaaaagaatttggtgaattttaa

KEGG   Pongo abelii (Sumatran orangutan): 100431906
Entry
100431906         CDS       T01416                                 

Gene name
PRKACG
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit gamma isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04020  Calcium signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04114  Oocyte meiosis
pon04140  Autophagy - animal
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04310  Wnt signaling pathway
pon04340  Hedgehog signaling pathway
pon04371  Apelin signaling pathway
pon04530  Tight junction
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04714  Thermogenesis
pon04720  Long-term potentiation
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04740  Olfactory transduction
pon04742  Taste transduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04910  Insulin signaling pathway
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04919  Thyroid hormone signaling pathway
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04961  Endocrine and other factor-regulated calcium reabsorption
pon04962  Vasopressin-regulated water reabsorption
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04976  Bile secretion
pon05012  Parkinson disease
pon05020  Prion disease
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05032  Morphine addiction
pon05034  Alcoholism
pon05146  Amoebiasis
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100431906 (PRKACG)
   04014 Ras signaling pathway
    100431906 (PRKACG)
   04310 Wnt signaling pathway
    100431906 (PRKACG)
   04340 Hedgehog signaling pathway
    100431906 (PRKACG)
   04371 Apelin signaling pathway
    100431906 (PRKACG)
   04020 Calcium signaling pathway
    100431906 (PRKACG)
   04024 cAMP signaling pathway
    100431906 (PRKACG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100431906 (PRKACG)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100431906 (PRKACG)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100431906 (PRKACG)
   04540 Gap junction
    100431906 (PRKACG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100431906 (PRKACG)
   04062 Chemokine signaling pathway
    100431906 (PRKACG)
  09152 Endocrine system
   04911 Insulin secretion
    100431906 (PRKACG)
   04910 Insulin signaling pathway
    100431906 (PRKACG)
   04922 Glucagon signaling pathway
    100431906 (PRKACG)
   04923 Regulation of lipolysis in adipocytes
    100431906 (PRKACG)
   04912 GnRH signaling pathway
    100431906 (PRKACG)
   04913 Ovarian steroidogenesis
    100431906 (PRKACG)
   04915 Estrogen signaling pathway
    100431906 (PRKACG)
   04914 Progesterone-mediated oocyte maturation
    100431906 (PRKACG)
   04921 Oxytocin signaling pathway
    100431906 (PRKACG)
   04926 Relaxin signaling pathway
    100431906 (PRKACG)
   04935 Growth hormone synthesis, secretion and action
    100431906 (PRKACG)
   04918 Thyroid hormone synthesis
    100431906 (PRKACG)
   04919 Thyroid hormone signaling pathway
    100431906 (PRKACG)
   04928 Parathyroid hormone synthesis, secretion and action
    100431906 (PRKACG)
   04916 Melanogenesis
    100431906 (PRKACG)
   04924 Renin secretion
    100431906 (PRKACG)
   04925 Aldosterone synthesis and secretion
    100431906 (PRKACG)
   04927 Cortisol synthesis and secretion
    100431906 (PRKACG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100431906 (PRKACG)
   04270 Vascular smooth muscle contraction
    100431906 (PRKACG)
  09154 Digestive system
   04970 Salivary secretion
    100431906 (PRKACG)
   04971 Gastric acid secretion
    100431906 (PRKACG)
   04976 Bile secretion
    100431906 (PRKACG)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100431906 (PRKACG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100431906 (PRKACG)
  09156 Nervous system
   04724 Glutamatergic synapse
    100431906 (PRKACG)
   04727 GABAergic synapse
    100431906 (PRKACG)
   04725 Cholinergic synapse
    100431906 (PRKACG)
   04728 Dopaminergic synapse
    100431906 (PRKACG)
   04726 Serotonergic synapse
    100431906 (PRKACG)
   04720 Long-term potentiation
    100431906 (PRKACG)
   04723 Retrograde endocannabinoid signaling
    100431906 (PRKACG)
  09157 Sensory system
   04740 Olfactory transduction
    100431906 (PRKACG)
   04742 Taste transduction
    100431906 (PRKACG)
   04750 Inflammatory mediator regulation of TRP channels
    100431906 (PRKACG)
  09149 Aging
   04211 Longevity regulating pathway
    100431906 (PRKACG)
   04213 Longevity regulating pathway - multiple species
    100431906 (PRKACG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100431906 (PRKACG)
   04714 Thermogenesis
    100431906 (PRKACG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100431906 (PRKACG)
   05205 Proteoglycans in cancer
    100431906 (PRKACG)
   05203 Viral carcinogenesis
    100431906 (PRKACG)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100431906 (PRKACG)
   05020 Prion disease
    100431906 (PRKACG)
  09165 Substance dependence
   05030 Cocaine addiction
    100431906 (PRKACG)
   05031 Amphetamine addiction
    100431906 (PRKACG)
   05032 Morphine addiction
    100431906 (PRKACG)
   05034 Alcoholism
    100431906 (PRKACG)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100431906 (PRKACG)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100431906 (PRKACG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100431906 (PRKACG)
   05163 Human cytomegalovirus infection
    100431906 (PRKACG)
   05165 Human papillomavirus infection
    100431906 (PRKACG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100431906 (PRKACG)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100431906 (PRKACG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100431906 (PRKACG)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100431906 (PRKACG)
   03036 Chromosome and associated proteins [BR:pon03036]
    100431906 (PRKACG)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100431906 (PRKACG)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  PKA family
   100431906 (PRKACG)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100431906 (PRKACG)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100431906 (PRKACG)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo Haspin_kinase RIO1
Other DBs
NCBI-GeneID: 100431906
NCBI-ProteinID: XP_003777433
Ensembl: ENSPPYG00000019273
UniProt: H2PSB7 A0A6D2WX47
LinkDB
Position
9
AA seq 351 aa
MGNAPAKKDTEQEKSATEFLVKARGDFLYRWGNPAQNTASSDQFERLRTLGTGSFGRVML
VRHRETGGHYAMKILHKQKLVKLKQVEHTLNEKRILQAIDFPFLVKLQFSFKDNSYLYLV
MEYVPGGEMFSHLRRVGSFSEPHACFYAAQVVLAFQYLHSLDLIHRDLKPENLLIDQQGY
LRVTDFGFAKRVKGRTWTLCGTPQYLAPEIILSKGYNKAVDWWALGVLIYEMTVGFPPFY
ADEPIQIYEKIVSGRVRFPSKLSSDLKDLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFAT
TSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacgcccccgccaagaaggacaccgagcaggagaagagcgcgacggagttccta
gtcaaagccagaggagatttcctctacagatggggaaaccccgctcaaaacaccgccagc
tccgatcagtttgaacggctcaggacgctgggcaccggctccttcgggcgggtgatgctg
gtgaggcaccgggagaccggcggccactacgccatgaagatccttcacaagcagaagctg
gtgaagctgaagcaggtcgagcacacactgaacgagaagcgcatcctgcaggcgatcgac
tttccgttcctcgtcaagctccagttctcctttaaggacaactcctacctgtacctggtg
atggagtacgtgccgggtggggagatgttctcccacctacggcgcgtcggaagtttcagc
gagccccatgcctgtttctatgccgcccaggtcgtcctggccttccagtacctacactcg
cttgacctcatccaccgcgacctgaagcccgagaatctcctcatcgaccagcagggctac
ctgcgggtgacggacttcggtttcgccaagcgcgtgaagggccgtacttggaccttgtgc
gggaccccacagtacctggcccccgagatcatcctgagcaaaggctacaacaaggccgtg
gactggtgggccctaggggtgctcatctatgagatgactgtgggcttcccacccttctac
gccgacgaacccatccagatctacgagaagatcgtctctgggagggtgcggtttccctcc
aaactcagctctgacctcaaggatctgctgcggagcctgctccaggtggacctcaccaag
cgcttcggaaacctcaggaacggggttggcgacatcaagaaccacaagtggttcgccaca
accagctggatcgccatctatgagaagaaggtggaagcccccttcatcccgaagtacaca
ggccctggggatgccagtaactttgacgactacgaggaggaagagctccggatctccatc
aatgagaagtgtgccaaggagttttctgagttttag

KEGG   Pongo abelii (Sumatran orangutan): 100437102
Entry
100437102         CDS       T01416                                 

Gene name
PRKACA
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04020  Calcium signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04114  Oocyte meiosis
pon04140  Autophagy - animal
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04310  Wnt signaling pathway
pon04340  Hedgehog signaling pathway
pon04371  Apelin signaling pathway
pon04530  Tight junction
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04714  Thermogenesis
pon04720  Long-term potentiation
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04740  Olfactory transduction
pon04742  Taste transduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04910  Insulin signaling pathway
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04919  Thyroid hormone signaling pathway
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04961  Endocrine and other factor-regulated calcium reabsorption
pon04962  Vasopressin-regulated water reabsorption
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04976  Bile secretion
pon05012  Parkinson disease
pon05020  Prion disease
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05032  Morphine addiction
pon05034  Alcoholism
pon05146  Amoebiasis
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100437102 (PRKACA)
   04014 Ras signaling pathway
    100437102 (PRKACA)
   04310 Wnt signaling pathway
    100437102 (PRKACA)
   04340 Hedgehog signaling pathway
    100437102 (PRKACA)
   04371 Apelin signaling pathway
    100437102 (PRKACA)
   04020 Calcium signaling pathway
    100437102 (PRKACA)
   04024 cAMP signaling pathway
    100437102 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100437102 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100437102 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100437102 (PRKACA)
   04540 Gap junction
    100437102 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100437102 (PRKACA)
   04062 Chemokine signaling pathway
    100437102 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    100437102 (PRKACA)
   04910 Insulin signaling pathway
    100437102 (PRKACA)
   04922 Glucagon signaling pathway
    100437102 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    100437102 (PRKACA)
   04912 GnRH signaling pathway
    100437102 (PRKACA)
   04913 Ovarian steroidogenesis
    100437102 (PRKACA)
   04915 Estrogen signaling pathway
    100437102 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    100437102 (PRKACA)
   04921 Oxytocin signaling pathway
    100437102 (PRKACA)
   04926 Relaxin signaling pathway
    100437102 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    100437102 (PRKACA)
   04918 Thyroid hormone synthesis
    100437102 (PRKACA)
   04919 Thyroid hormone signaling pathway
    100437102 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    100437102 (PRKACA)
   04916 Melanogenesis
    100437102 (PRKACA)
   04924 Renin secretion
    100437102 (PRKACA)
   04925 Aldosterone synthesis and secretion
    100437102 (PRKACA)
   04927 Cortisol synthesis and secretion
    100437102 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100437102 (PRKACA)
   04270 Vascular smooth muscle contraction
    100437102 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    100437102 (PRKACA)
   04971 Gastric acid secretion
    100437102 (PRKACA)
   04976 Bile secretion
    100437102 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100437102 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100437102 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    100437102 (PRKACA)
   04727 GABAergic synapse
    100437102 (PRKACA)
   04725 Cholinergic synapse
    100437102 (PRKACA)
   04728 Dopaminergic synapse
    100437102 (PRKACA)
   04726 Serotonergic synapse
    100437102 (PRKACA)
   04720 Long-term potentiation
    100437102 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    100437102 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    100437102 (PRKACA)
   04742 Taste transduction
    100437102 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    100437102 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    100437102 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    100437102 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100437102 (PRKACA)
   04714 Thermogenesis
    100437102 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100437102 (PRKACA)
   05205 Proteoglycans in cancer
    100437102 (PRKACA)
   05203 Viral carcinogenesis
    100437102 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100437102 (PRKACA)
   05020 Prion disease
    100437102 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    100437102 (PRKACA)
   05031 Amphetamine addiction
    100437102 (PRKACA)
   05032 Morphine addiction
    100437102 (PRKACA)
   05034 Alcoholism
    100437102 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100437102 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100437102 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100437102 (PRKACA)
   05163 Human cytomegalovirus infection
    100437102 (PRKACA)
   05165 Human papillomavirus infection
    100437102 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100437102 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100437102 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100437102 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100437102 (PRKACA)
   03036 Chromosome and associated proteins [BR:pon03036]
    100437102 (PRKACA)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100437102 (PRKACA)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  PKA family
   100437102 (PRKACA)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100437102 (PRKACA)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100437102 (PRKACA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 100437102
NCBI-ProteinID: XP_024092812
LinkDB
Position
19
AA seq 351 aa
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacgccgccgccgccaagaagggcagcgagcaggagagcgtgaaagaattctta
gccaaagccaaagaagattttcttaaaaaatgggaaagtcccgctcagaacacagcccac
ttggatcagtttgaacgaatcaagaccctcggcacgggctccttcgggcgggtgatgctg
gtgaaacacaaggagaccgggaaccactatgccatgaagatcctcgacaaacagaaggtg
gtgaaactgaaacagatagaacacaccctgaatgaaaagcgcatcctgcaagccgtcaac
tttccgttcctcgtcaaactcgagttctccttcaaggacaactcaaacttatacatggtc
atggagtacgtgcccggcggggagatgttctcacacctacggcggatcggaaggttcagc
gagccccatgcccgtttctacgcggcccagatcgtcctgacctttgagtatctgcactcg
ctggatctcatctacagagacctgaaaccggagaatctgctgattgaccagcagggctac
attcaggtgacagacttcggtttcgccaagcgcgtgaagggccgcacttggaccttgtgt
ggcacccctgagtacctggcccctgagattatcctgagcaaaggctacaacaaggccgtg
gactggtgggccctgggggttcttatctatgaaatggccgctggctacccgcccttcttc
gcagaccagcccatccagatctatgagaagatcgtctctgggaaggtgcggttcccttcc
cacttcagctctgacttgaaggacctgctgcggaacctcctgcaggtagatctcaccaag
cgctttgggaacctcaagaatggggtcaacgatatcaagaaccacaagtggtttgccaca
actgactggattgccatctaccagaggaaggtggaagctcccttcataccaaagtttaaa
ggccctggggatacgagtaactttgacgactatgaggaagaagaaatccgggtctccatc
aatgagaagtgtggcaaggagttttctgagttttag

DBGET integrated database retrieval system