KEGG   Pongo abelii (Sumatran orangutan): 100189735
Entry
100189735         CDS       T01416                                 

Gene name
FHL1
Definition
(RefSeq) four and a half LIM domains protein 1 precursor
  KO
K14365  four and a half LIM domains protein 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100189735 (FHL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100189735 (FHL1)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 LIM domain-containing proteins
  FHL family proteins
   100189735 (FHL1)
SSDB
Motif
Pfam: LIM Ureidogly_lyase
Other DBs
NCBI-GeneID: 100189735
NCBI-ProteinID: NP_001128823
Ensembl: ENSPPYG00000020761
UniProt: Q5R9D8
LinkDB
Position
X
AA seq 309 aa
MTFYVASLALELIWMLSSPAGPSSYKVGTMAEKFDCHYCRDPLQGKKYVQKDGHHCCLKC
FDKFCANTCVECRKPIGADSKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNK
CTTREDSPKCKGCFKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGEDFYCV
TCHETKFAKHCVKCNKAITSGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCVD
CYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKKCSVNLANKRFVFHQEQV
YCPDCAKKL
NT seq 930 nt   +upstreamnt  +downstreamnt
atgactttctatgtggcctctctggctctggagctaatttggatgctgagtagccccgca
ggtccctccagctacaaggtgggcaccatggcggagaagtttgactgccactactgcagg
gatcccttgcaggggaagaagtatgtgcaaaaggatggccaccactgctgcctgaaatgc
tttgacaagttctgtgccaacacctgtgtggaatgccgcaagcccatcggtgcggactcc
aaggaggtgcactataagaaccgcttctggcacgacacctgcttccgctgtgccaagtgc
cttcaccccttggccaatgagacctttgtggccaaggacaacaagatcctgtgcaacaag
tgcaccactcgggaggactcccccaagtgcaaggggtgcttcaaggccattgtggcagga
gatcaaaacgtggagtacaaggggaccgtctggcacaaagactgcttcacctgtagtaac
tgcaagcaagtcatcgggactggaagcttcttccctaaaggggaggacttctactgcgtg
acttgccatgagaccaagtttgccaagcattgcgtgaagtgcaacaaggccatcacatct
ggaggaatcacttaccaggatcagccctggcatgccgattgctttgtgtgtgttacctgc
tctaagaagctggctgggcagcgtttcaccgctgtggaggaccagtattactgcgtggat
tgctacaagaactttgtggccaagaagtgtgctggatgcaagaaccccatcactgggttt
ggtaaaggctccagtgtggtggcctatgaaggacaatcctggcacgactactgcttccac
tgcaaaaaatgctccgtgaatctggccaacaagcgctttgttttccaccaggagcaagtg
tattgccccgactgtgccaaaaagctgtaa

DBGET integrated database retrieval system