KEGG   Pongo abelii (Sumatran orangutan): 100431221
Entry
100431221         CDS       T01416                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon01100  Metabolic pathways
pon01522  Endocrine resistance
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04072  Phospholipase D signaling pathway
pon04114  Oocyte meiosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04714  Thermogenesis
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04727  GABAergic synapse
pon04740  Olfactory transduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04921  Oxytocin signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04962  Vasopressin-regulated water reabsorption
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon04976  Bile secretion
pon05032  Morphine addiction
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100431221 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100431221 (ADCY3)
   04371 Apelin signaling pathway
    100431221 (ADCY3)
   04020 Calcium signaling pathway
    100431221 (ADCY3)
   04072 Phospholipase D signaling pathway
    100431221 (ADCY3)
   04024 cAMP signaling pathway
    100431221 (ADCY3)
   04022 cGMP-PKG signaling pathway
    100431221 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100431221 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100431221 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100431221 (ADCY3)
   04062 Chemokine signaling pathway
    100431221 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    100431221 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    100431221 (ADCY3)
   04912 GnRH signaling pathway
    100431221 (ADCY3)
   04913 Ovarian steroidogenesis
    100431221 (ADCY3)
   04915 Estrogen signaling pathway
    100431221 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    100431221 (ADCY3)
   04921 Oxytocin signaling pathway
    100431221 (ADCY3)
   04926 Relaxin signaling pathway
    100431221 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    100431221 (ADCY3)
   04918 Thyroid hormone synthesis
    100431221 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    100431221 (ADCY3)
   04916 Melanogenesis
    100431221 (ADCY3)
   04925 Aldosterone synthesis and secretion
    100431221 (ADCY3)
   04927 Cortisol synthesis and secretion
    100431221 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100431221 (ADCY3)
   04270 Vascular smooth muscle contraction
    100431221 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    100431221 (ADCY3)
   04971 Gastric acid secretion
    100431221 (ADCY3)
   04972 Pancreatic secretion
    100431221 (ADCY3)
   04976 Bile secretion
    100431221 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100431221 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100431221 (ADCY3)
   04727 GABAergic synapse
    100431221 (ADCY3)
   04725 Cholinergic synapse
    100431221 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    100431221 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    100431221 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    100431221 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    100431221 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    100431221 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100431221 (ADCY3)
   04714 Thermogenesis
    100431221 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100431221 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    100431221 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100431221 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100431221 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100431221 (ADCY3)
   05163 Human cytomegalovirus infection
    100431221 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100431221 (ADCY3)
Enzymes [BR:pon01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100431221 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA OPA3 Peptidase_S49_N
Other DBs
NCBI-GeneID: 100431221
NCBI-ProteinID: XP_024098015
Ensembl: ENSPPYG00000012595
LinkDB
Position
2A
AA seq 1158 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLALLAVAGIGLVLDII
LFVLCKKGLLPDRVTRRVVPYVLWLLITAQIFSYLGLNFARAHAASDTVGWQVFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQEELKGMQLLREILANVFLYLCAIAVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLEEKGIETYLIIASKPEVKKIATQNGLNGSALPNGAPVSSKSSSPALIETKEPNGSAHS
SGSMSEKPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YVTFVVGEILLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPGNATAGMETEGGCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVAGAVATINLYAWRPIFDEYDHKRFREHDLPMVALEKMQGFTPRLNGTDSRLPLVPSK
YSMTAMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFASSNKEDKSERERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVCPGAEPARAQTQGMGTKPDSAFPRALPPTLAPGPWPRTVSPRAEAWGQWKGVSA
VASLSSGRNTSTHPQNLG
NT seq 3477 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgagcccgaatactcggccgagtactcagccgagtac
tccgtcagcctgccctccgaccctgaccgcggggtgggccggacccatgaaatctcggtc
cggaactccggctcctgcctgtgcctgcctcgcttcatgcggctgaccttcgtgccggag
tccttggagaacctctaccagacctacttcaaaaggcagcgccacgagaccctgctggtg
ctggtggtctttgcagccctctttgactgctacgtggtggtcatgtgtgctgtggtcttc
tccagcgacaagctggctctcctcgccgtggctggaattggactggtgttggacatcatc
ctcttcgtgctctgcaaaaaggggctgctcccggaccgggtcacccgcagagtggtgccc
tacgtgctgtggctgctcataaccgcccagatcttctcctacctgggcctgaacttcgcg
cgtgcccacgcggctagtgacacggtgggctggcaggtcttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtgatcatctccgtggtctcctgtgtggtg
cacacgttggtcctgggggtcaccgtggcccagcagcagcaggaggagctgaaggggatg
cagctgctgcgggagatcctggccaacgtcttcctctacctgtgcgccatcgctgtgggc
atcatgtcctactacatggctgaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaagagcagagccagcagcaggagaacctcatgctt
tccatcctgcccaagcacgtggctgacgagatgctgaaagacatgaagaaagacgagagc
cagaaggatcagcagcagttcaacaccatgtacatgtaccgccacgagaacgtcagcatc
ctctttgctgacatcgtgggctttacccagctgtcttctgcctgcagtgcccaggagctc
gtgaagctgctcaacgagctctttgcccgctttgacaagctggcagctaaataccaccag
ctgcggattaagatcctgggcgactgctactactgcatctgcggcttgcctgactaccgg
gaggaccacgccgtctgctccatcctcatggggctggccatggtggaggccatctcgtat
gtgcgggagaagaccaagactggggtggacatgcgtgtgggggtgcacacgggcaccgtg
ctggggggcgtcctgggccagaagcgctggcagtacgacgtgtggtcgactgatgtcact
gtagccaacaagatggaggccggcggcatccctgggcgcgtgcacatctcccagagcacc
atggactgcctgaaaggggagtttgatgtggagccaggcgatgggggcagccgctgtgat
tacctagaagagaagggtattgaaacctacctcatcattgcctccaagccagaggtgaag
aaaatagccacccagaatggcctcaatggctcggccctgcccaatggagcgccagtttcc
tcaaagtccagctcccctgccctcattgagaccaaggagcccaatgggagtgcccacagc
agcgggtccatgtcagagaagcccgaggagcaggatgcccaggccgacaacccctcattc
cccaacccacgccggaggctgcgcctgcaggacctggctgaccgagtggtggacgcctct
gaagatgagcacgagctcaaccagctgctcaacgaggccctgctcgagcgagagtctgcc
caagtagtaaagaagagaaacaccttcctcttgtccatgcggttcatggaccccgagatg
gaaacccgctactcggtggagaaggagaagcagagtggggctgccttcagctgctcctgc
gtcgtcctgctctgcacggccctggtcgagatactcatcgacccctggctaatgacaaac
tatgtgaccttcgtggtaggggagattctgctcctcatcctgaccatctgctccctggct
gccatctttccccgggcctttcctaagaagcttgtggccttctcgacttggattgaccgg
acccgctgggccaggaacacctgggccatgctcgccatcttcatccttgtgatggcaaat
gtcgtggacatgctcagctgtctccagtactacacgggacccggcaatgcgacggcaggg
atggagacggagggcggctgcctggagaaccccaagtattacaactacgtggccgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacgctcatg
ctgctcgtcgcgggcgccgtggccaccatcaacctctatgcctggcgccccatctttgat
gaatacgaccacaagcgttttcgggagcatgacttacctatggtggccttagagaagatg
caaggattcacccctaggctcaacggcactgacagcaggctgcccctggtgccttccaag
tactccatgacggcgatggtgttcctcatgatgctgagcttctactacttctcccgccat
gtagaaaaactggcacggacacttttcttgtggaagattgaggtccacgaccagaaggaa
cgtgtctatgagatgcgacgctggaacgaggccttggtcaccaacatgttgcctgagcac
gtggcacgccatttcctggggtccaagaagagagatgaggagctgtatagtcagacgtat
gatgagattggagtcatgtttgcctccctgcccaactttgctgacttctacacagaggag
agcatcaacaatggtggtattgagtgtctgcgttttctcaatgaaatcatctcggatttt
gactctctcctggacaatcccaagttccgtgtgatcaccaagatcaaaaccattggcagc
acgtatatggcggcttcaggagtcacccccgatgtcaacaccaatggctttgccagttcc
aacaaggaggacaagtccgagagagagcgctggcagcacctggctgacctggccgacttc
gcgctggccatgaaggatacgctcaccaacatcaacaaccagtccttcaataacttcatg
ctgcgcataggcatgaacaaaggcggggttctggctggggtcatcggagcccggaaacca
cactacgacatctggggcaatacagtcaatgtagccagcaggatggagtccacgggggtc
atgggcaacattcaggtatgtccaggggcagagccggcacgtgctcagactcagggcatg
ggaacaaaaccggacagtgctttcccacgcgccctgcctcccacactggcccctggcccc
tggccccgaacagtgagtccgcgggcagaggcgtggggccagtggaaaggagtctctgca
gtagctagcctcagctcagggagaaacacttccacccatccacaaaatctgggctga

KEGG   Pongo abelii (Sumatran orangutan): 100436577
Entry
100436577         CDS       T01416                                 

Gene name
ADCY7
Definition
(RefSeq) adenylate cyclase type 7
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon01100  Metabolic pathways
pon01522  Endocrine resistance
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04072  Phospholipase D signaling pathway
pon04114  Oocyte meiosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04714  Thermogenesis
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04727  GABAergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04921  Oxytocin signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon04976  Bile secretion
pon05032  Morphine addiction
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100436577 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100436577 (ADCY7)
   04371 Apelin signaling pathway
    100436577 (ADCY7)
   04020 Calcium signaling pathway
    100436577 (ADCY7)
   04072 Phospholipase D signaling pathway
    100436577 (ADCY7)
   04024 cAMP signaling pathway
    100436577 (ADCY7)
   04022 cGMP-PKG signaling pathway
    100436577 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100436577 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100436577 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100436577 (ADCY7)
   04062 Chemokine signaling pathway
    100436577 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    100436577 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    100436577 (ADCY7)
   04912 GnRH signaling pathway
    100436577 (ADCY7)
   04913 Ovarian steroidogenesis
    100436577 (ADCY7)
   04915 Estrogen signaling pathway
    100436577 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    100436577 (ADCY7)
   04921 Oxytocin signaling pathway
    100436577 (ADCY7)
   04926 Relaxin signaling pathway
    100436577 (ADCY7)
   04935 Growth hormone synthesis, secretion and action
    100436577 (ADCY7)
   04918 Thyroid hormone synthesis
    100436577 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    100436577 (ADCY7)
   04916 Melanogenesis
    100436577 (ADCY7)
   04925 Aldosterone synthesis and secretion
    100436577 (ADCY7)
   04927 Cortisol synthesis and secretion
    100436577 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100436577 (ADCY7)
   04270 Vascular smooth muscle contraction
    100436577 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    100436577 (ADCY7)
   04971 Gastric acid secretion
    100436577 (ADCY7)
   04972 Pancreatic secretion
    100436577 (ADCY7)
   04976 Bile secretion
    100436577 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    100436577 (ADCY7)
   04727 GABAergic synapse
    100436577 (ADCY7)
   04725 Cholinergic synapse
    100436577 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    100436577 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100436577 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    100436577 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    100436577 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100436577 (ADCY7)
   04714 Thermogenesis
    100436577 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100436577 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    100436577 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100436577 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100436577 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100436577 (ADCY7)
   05163 Human cytomegalovirus infection
    100436577 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100436577 (ADCY7)
Enzymes [BR:pon01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100436577 (ADCY7)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 100436577
NCBI-ProteinID: XP_009248980
Ensembl: ENSPPYG00000007338
UniProt: H2NQV2
LinkDB
Position
16
AA seq 1080 aa
MPAKGRYFLNEGEEGPDQDALYEKYQLTSHHGPLLLTLLLVAATACVALIIIVFSQGDPS
RHQAILGMAFLALAVFAALSVLMYVECLLRRWLRALALLTWACLVVLGYVLVFDAWTKAA
CAWEQVPFFLFIVFVVYTLLPFSMRGAVAVGAVSTASHLLVLGALMGGFTTPSVRVGLQL
LANAVIFLCGNLTGAFHKHQMQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAH
ISMGMKLAIIERLKEHGDRRCMPDNNFHSLYVKRHQNVSILYADIVGFTQLASDCSPKEL
VVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDMCQAIKQ
VREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
LKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQHLPRPKGDAALKMRA
SVRMTRYLESWGAARPFAHLNHRESVSSGETPVPNGRRPKSVPQRHRRTPDRSMSPKGRS
EDDSYDDEMLSAIEGLSSTRPCCSKSDDFYTFGSIFLEKGFEREYRLAPIPRARHDFACA
SLIFICILLVHVLLMPRTAALGVSFGLVACVLGLVLGLCFATKFSRCCPARGTLCTISER
VETQPLLRLTLAVLTIGSLLTVAIINLPLMPFPVPELPVGNETGLPAASSKTRALCEPLP
YYTCSCVLGFIACSVFLRMSLEPKVVLLTVALVAYLVLFNLSPCWQGDCCGQGLGNLTEP
NSTTSGTPSCSWKDLKTMTNFYLVLFYITLLTLSRQIDYYCRLDCLWKKKFKNEHEEFET
MENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKE
GLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVTSGHENQELERQHAH
IGVMVEFSIALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVAS
RMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGELRTYFVCTDTAKFQGLGLN
NT seq 3243 nt   +upstreamnt  +downstreamnt
atgccagccaaggggcgctacttcctcaacgagggcgaggagggccctgaccaagatgcg
ctctacgagaagtaccagctcaccagccatcatgggccactgctgctcacgctcctgctg
gtggccgccactgcctgtgtggccctcatcatcatcgtcttcagccagggggacccctcc
agacaccaggccattctgggcatggcgttcctggcgctggcggtgtttgcagccctctct
gtgctgatgtacgtcgagtgtctcctgcggcgctggctcagggccttggcgctgctcacc
tgggcctgcttggtggtgctgggctacgtgctggtgtttgacgcatggacaaaggcggcc
tgtgcgtgggagcaggtgcccttcttcctgttcatcgtcttcgtggtgtacacactgctg
cccttcagcatgcggggcgctgtcgccgttggggccgtctctactgcctcccacctcctg
gtgctcggtgctttgatgggaggcttcacaacacccagtgtccgggtggggctgcagctg
ctggccaacgcagtcatcttcctgtgcgggaacctgacaggcgccttccacaagcaccaa
atgcaggatgcgtcccgggacctcttcacctacactgtgaagtgcatccagatccgccgg
aagctgcgcatcgagaagcgccagcaggagaacctgctgctgtcggtgcttccggcccac
atctccatgggcatgaagctggccatcattgaacggctcaaggagcatggcgaccgtcgc
tgcatgcctgacaacaacttccacagcctctacgtcaaaaggcaccagaatgtcagcatc
ctctatgcggacattgtgggcttcacgcagctggccagcgactgttcccccaaggagttg
gtggtggtgctgaatgagctctttggcaagttcgaccagatcgccaaggccaacgagtgc
atgcgaatcaagatcctcggtgactgctattactgtgtatcgggcctgcccgtgtcgctg
cccacccacgcccggaactgcgtgaagatggggctggacatgtgccaggccatcaagcag
gtgcgggaggccacgggtgtggacatcagcatgcgtgtgggcatacactcggggaatgtg
ctgtgcggggtcatcgggctgcgcaaatggcagtatgacgtgtggtcccacgatgtgtcc
ctggccaaccggatggaggcagccggagtacccggccgtgtgcacatcacggaggcgacg
ctgaagcacctggacaaggcgtacgaggtggaagacgggcacgggcagcagcgggacccc
tacctcaaggagatgaacatccgaacctacctggtcatcgacccccggagccagcagcca
cccccgcccagccaacacctccccaggcccaagggggacgcggccctgaagatgcgggcg
tcagtgcgcatgacccggtacctcgagtcctggggggcggcacggccctttgcgcatctc
aaccaccgtgagagcgtgagcagtggtgagacccccgtccccaacgggcggaggcctaag
agcgttccccagcgccaccgccggaccccagacagaagcatgtcccccaaggggcggtcg
gaggatgactcgtacgatgatgagatgctgtcagccatcgaggggctcagctccacgagg
ccctgctgctccaagtccgacgacttctacactttcgggtccatcttcctggagaagggc
tttgagcgcgagtaccgcctggcacccatcccccgggcccgccacgactttgcctgcgcc
agcctgatcttcatctgcatcctgctcgtccatgtcctgctcatgcccaggacggcggca
ctgggtgtgtccttcgggctggtggcctgtgtactggggctggtgctgggcctgtgcttt
gccaccaagttctcgaggtgctgcccagcccgggggacgctctgcactatctctgagagg
gtggagacgcagcccctgctgaggctgaccctggccgtcctgaccatcggcagcctgctc
actgtggccatcatcaacctgcccctgatgcctttcccagtcccagagctgcctgttggc
aatgagacaggcctaccggccgcaagcagcaagacaagagccctgtgcgagcccctcccg
tactacacctgcagctgtgtcctgggcttcatcgcctgctccgtcttcctgaggatgagc
ctggagccaaaggttgtgctgctgacagtggccctggtggcctacctggtgctcttcaac
ctctccccatgctggcagggggactgctgcggccaaggcctgggcaacctcactgagccc
aacagcaccaccagcggcacccctagctgttcctggaaggacctgaagaccatgaccaat
ttctacctggtcctgttctacatcaccctgctcactctctccagacagatagactattac
tgccgcttggactgcctatggaagaagaagttcaagaacgagcacgaggagtttgagacc
atggagaatgtgaaccgccttcttctggagaacgtcctgccagcccacgtggctgcccac
tttattggtgacaagttaaacgaggactggtaccatcagtcctatgactgcgtctgtgtc
atgtttgcctccgtaccggactttaaagtgttctacacggagtgtgatgtcaacaaagaa
gggctggagtgcttgcgcctgctcaatgagatcattgccgacttcgacgagctcctactg
aagcccaagttcagcggtgtggagaagatcaagaccatcggcagcacgtacatggcagct
gcagggctcagtgtcacctcagggcacgagaaccaggagctggagcggcagcatgcccac
attggtgtcatggtggagttcagcatcgccctgatgagtaagctggacggcatcaacagg
cactccttcaactccttccgcctccgagtcggcataaaccatgggcctgtgattgctgga
gtgattggggcccgaaaacctcagtatgacatctggggaaacacagtcaacgtggccagc
cgaatggagagcactggagaacttgggaaaatccaggttaccgaggagacctgcaccatc
ctccagggcctcgggtactcttgtgaatgccgtggcctgatcaatgtcaaaggcaaaggc
gagctgaggacttactttgtctgtacggacactgccaagtttcaggggctggggctgaac
tga

KEGG   Pongo abelii (Sumatran orangutan): 100438178
Entry
100438178         CDS       T01416                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase type 6 isoform X1
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon01100  Metabolic pathways
pon01522  Endocrine resistance
pon04015  Rap1 signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04072  Phospholipase D signaling pathway
pon04114  Oocyte meiosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04714  Thermogenesis
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04727  GABAergic synapse
pon04742  Taste transduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04921  Oxytocin signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04961  Endocrine and other factor-regulated calcium reabsorption
pon04962  Vasopressin-regulated water reabsorption
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon04976  Bile secretion
pon05032  Morphine addiction
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100438178 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100438178 (ADCY6)
   04371 Apelin signaling pathway
    100438178 (ADCY6)
   04072 Phospholipase D signaling pathway
    100438178 (ADCY6)
   04024 cAMP signaling pathway
    100438178 (ADCY6)
   04022 cGMP-PKG signaling pathway
    100438178 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100438178 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100438178 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100438178 (ADCY6)
   04062 Chemokine signaling pathway
    100438178 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    100438178 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    100438178 (ADCY6)
   04912 GnRH signaling pathway
    100438178 (ADCY6)
   04913 Ovarian steroidogenesis
    100438178 (ADCY6)
   04915 Estrogen signaling pathway
    100438178 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    100438178 (ADCY6)
   04921 Oxytocin signaling pathway
    100438178 (ADCY6)
   04926 Relaxin signaling pathway
    100438178 (ADCY6)
   04935 Growth hormone synthesis, secretion and action
    100438178 (ADCY6)
   04918 Thyroid hormone synthesis
    100438178 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    100438178 (ADCY6)
   04916 Melanogenesis
    100438178 (ADCY6)
   04924 Renin secretion
    100438178 (ADCY6)
   04925 Aldosterone synthesis and secretion
    100438178 (ADCY6)
   04927 Cortisol synthesis and secretion
    100438178 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100438178 (ADCY6)
   04270 Vascular smooth muscle contraction
    100438178 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    100438178 (ADCY6)
   04971 Gastric acid secretion
    100438178 (ADCY6)
   04972 Pancreatic secretion
    100438178 (ADCY6)
   04976 Bile secretion
    100438178 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100438178 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100438178 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    100438178 (ADCY6)
   04727 GABAergic synapse
    100438178 (ADCY6)
   04725 Cholinergic synapse
    100438178 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    100438178 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    100438178 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    100438178 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    100438178 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    100438178 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100438178 (ADCY6)
   04714 Thermogenesis
    100438178 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100438178 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    100438178 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100438178 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100438178 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100438178 (ADCY6)
   05163 Human cytomegalovirus infection
    100438178 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100438178 (ADCY6)
Enzymes [BR:pon01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100438178 (ADCY6)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD Shisa Bestrophin
Other DBs
NCBI-GeneID: 100438178
NCBI-ProteinID: XP_024112797
Ensembl: ENSPPYG00000004466
LinkDB
Position
12
AA seq 1118 aa
MSWFSGLLVPKVDERKTAWGERNGQKRSRRRGTRAGGFCTPRYMSCLRDAEPPSPTPAGP
PRCPWQDDTFIRRGGPGKGKELGLRAVALGFEDTEVTTTAGGTAEVAPDTVSRSGRSCWR
RLVQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAY
VALLACAAALFVGLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPRSASAGLW
CPVFFVYIAYTLLPIRMRAAVLSGLGLSTLHLILAWQLNRGDAFLWKQERLLLSVLPQHV
AMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFAR
FDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVN
MRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEV
EPGRGGERNAYLKEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAF
SRTKDSKAFRQMGIDDSSKDNRGTQDALNPEDEVDEFLSRAIDARSIDQLRKDHVRRFLL
TFQREDLEKKYSRKVDPRFGAYVACALLVFCFICFIQLLIFPHSTLMLGIYASIFLLLLI
TVLICAVYSCGSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNYTPIR
TCAARMLNLTPADITACHLQQLNYSLGLDAPLCEGTMPTCSFPEYFIGNMLLSLLASSVF
LHISSIGKLAMIFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAG
RVALKYMTPVILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHN
ILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNE
IIADFDEIISEERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQM
KHINEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTT
DLYQVLAAKGYQLECRGLVKVKGKGEMTTYFLNGGPSS
NT seq 3357 nt   +upstreamnt  +downstreamnt
atgtcatggtttagtggcctcctggtccctaaagtggatgaacggaaaacagcctggggt
gaacgcaatgggcagaagcgttcgcggcgccgtggcactcgggcaggtggcttctgcacg
ccccgctatatgagctgcctccgggatgcagagccacccagccccacccctgcgggcccc
cctcggtgcccctggcaggatgacaccttcatccggaggggcggcccaggcaagggcaag
gagctggggctgcgggcagtggccctgggcttcgaggataccgaggtgacaacgacagcg
ggcgggacggctgaggtggcgcccgacacggtgtccaggagtgggcgatcctgctggcgc
cgtctggtgcaggtgttccagtcgaagcagttccgttcggccaagctggagcgcctgtac
cagcggtacttcttccagatgaaccagagcagcctgacgctgctgatggcggtgctggtg
ctgctcacggcggtgctgctggctttccacgccgcacccgcccgccctcagcctgcctat
gtggcactgttggcctgtgccgccgccctgttcgtggggctcatggtggtgtgtaaccgg
catagcttccgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctggcg
gcagtgcaggtcgggggcgccctcgcagcagacccgcgcagcgcctctgcgggcctctgg
tgccctgtgttctttgtctacatcgcctacaccctcctccccatccgcatgcgggctgcc
gtcctcagcggcctgggcctctccaccttgcatttgatcttggcctggcaacttaaccgt
ggtgatgccttcctctggaagcaggagcggctgctgctgtcggtattgccccagcacgtt
gccatggagatgaaagaagacatcaacacaaaaaaagaagacatgatgttccacaagatc
tacatacagaagcatgacaatgtcagcatcctgtttgcagacattgagggcttcactagc
ctggcatcccagtgcaccgcgcaggagctggtcatgaccctgaatgagctctttgcccgg
tttgacaagctggctgcggagaatcactgcctgaggatcaagatcttgggggactgttac
tactgtgtgtcagggctgccggaggcccgggccgaccatgcccactgctgtgtggagatg
ggggtagacatgatcgaggccatctcgctggtacgtgaggtgacaggtgtgaatgtgaac
atgcgcgtgggcatccacagcgggcgcgtgcactgcggcgtccttggcttgcggaaatgg
cagtttgatgtgtggtccaatgatgtgaccctggccaaccacatggaggcaggaggccgg
gctggccgcatccacatcactcgggcaacactgcagtacctgaacggggactacgaggtg
gagccaggccgtggtggtgagcgcaacgcgtacctcaaggagcagcacattgagactttc
ctcatcctgggcgccagccagaaacggaaagaggagaaggccatgctggccaagctgcag
cggactcgggccaactccatggaagggctgatgccgcgctgggtgcctgatcgcgccttc
tcccggaccaaggactccaaggccttccgccagatgggcattgatgattccagcaaagac
aaccggggcacccaagatgccctgaaccctgaggatgaggtggatgagttcctgagccgt
gccatcgatgcccgcagcattgatcagctgcggaaggaccatgtgcgccggtttctgctc
accttccagagagaggatcttgagaagaagtactcccggaaggtggatccccgctttgga
gcctacgttgcctgtgccctgttggtcttctgcttcatctgcttcatccagcttctcatc
ttcccacactccaccctgatgcttgggatctatgccagcatcttcctgctgctgctgatc
accgttctgatctgtgccgtgtactcctgtggttctctgttccctaaggccctgcaacgt
ctgtcccgcagcattgtccgctcacgggcacatagcaccgcagttggcatcttttccgtc
ctgctagtgtttacttctgccattgccaacatgttcacctgtaactacacccccatacgg
acatgtgcagcccggatgctgaatttaacacctgctgacatcactgcctgccacctgcag
cagctcaattactctctgggcctggatgctcccctgtgtgagggcaccatgcccacctgc
agcttccctgagtacttcatcgggaacatgctgctgagtctcttggccagctctgtcttc
ctgcacatcagcagcatcgggaagttggccatgatctttgtcttggggctcatctatttg
gtgctgcttctgctgggtcccccagccaccatctttgacaactatgacctactgcttggc
gtccatggcttggcttcttccaatgagacctttgatgggctggactgtccagctgcaggg
agggtggccctcaaatatatgacccctgtgattctgctggtgtttgctctggcgctgtat
ctgcatgctcagcaggtggagtcgactgcccgcctagacttcctctggaaactacaggca
acaggggagaaggaggagatggaggagctacaggcatacaaccggaggctgctgcataac
attctgcccaaggacgtggcggcccatttcctggcccgggagcgccgcaatgatgaactc
tactatcagtcgtgtgagtgtgtggcggttatgtttgcctccattgccaacttctctgag
ttctatgtggagctggaggcaaacaatgagggtgtcgagtgcctgcggctgctcaacgag
atcatcgctgactttgatgagattatcagcgaggagcggttccggcagctggaaaagatc
aagacgattggtagcacctacatggctgcctcagggctgaacgccagcacctacgatcag
gtgggccgctcccatatcactgccctggctgactacgccatgcggctcatggagcagatg
aagcacatcaatgagcactccttcaacaatttccagatgaagattgggctgaacatgggc
ccagtcgtggcaggtgtcatcggggctcggaagccacagtatgacatctgggggaacaca
gtgaatgtctctagtcgtatggacagcacgggggtccccgaccgaatccaggtgaccacg
gacctgtaccaggttctagctgccaagggctaccagctggagtgtcgagggctggtcaag
gtgaagggcaagggggagatgaccacctacttcctcaatgggggccccagcagttag

KEGG   Pongo abelii (Sumatran orangutan): 100445431
Entry
100445431         CDS       T01416                                 

Gene name
ADCY2
Definition
(RefSeq) adenylate cyclase type 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon01100  Metabolic pathways
pon01522  Endocrine resistance
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04072  Phospholipase D signaling pathway
pon04114  Oocyte meiosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04714  Thermogenesis
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04727  GABAergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon04976  Bile secretion
pon05032  Morphine addiction
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100445431 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100445431 (ADCY2)
   04371 Apelin signaling pathway
    100445431 (ADCY2)
   04020 Calcium signaling pathway
    100445431 (ADCY2)
   04072 Phospholipase D signaling pathway
    100445431 (ADCY2)
   04024 cAMP signaling pathway
    100445431 (ADCY2)
   04022 cGMP-PKG signaling pathway
    100445431 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100445431 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100445431 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100445431 (ADCY2)
   04062 Chemokine signaling pathway
    100445431 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    100445431 (ADCY2)
   04922 Glucagon signaling pathway
    100445431 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    100445431 (ADCY2)
   04912 GnRH signaling pathway
    100445431 (ADCY2)
   04913 Ovarian steroidogenesis
    100445431 (ADCY2)
   04915 Estrogen signaling pathway
    100445431 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    100445431 (ADCY2)
   04921 Oxytocin signaling pathway
    100445431 (ADCY2)
   04926 Relaxin signaling pathway
    100445431 (ADCY2)
   04935 Growth hormone synthesis, secretion and action
    100445431 (ADCY2)
   04918 Thyroid hormone synthesis
    100445431 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    100445431 (ADCY2)
   04916 Melanogenesis
    100445431 (ADCY2)
   04925 Aldosterone synthesis and secretion
    100445431 (ADCY2)
   04927 Cortisol synthesis and secretion
    100445431 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100445431 (ADCY2)
   04270 Vascular smooth muscle contraction
    100445431 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    100445431 (ADCY2)
   04971 Gastric acid secretion
    100445431 (ADCY2)
   04972 Pancreatic secretion
    100445431 (ADCY2)
   04976 Bile secretion
    100445431 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100445431 (ADCY2)
   04727 GABAergic synapse
    100445431 (ADCY2)
   04725 Cholinergic synapse
    100445431 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    100445431 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100445431 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    100445431 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    100445431 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100445431 (ADCY2)
   04714 Thermogenesis
    100445431 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100445431 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    100445431 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100445431 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100445431 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100445431 (ADCY2)
   05163 Human cytomegalovirus infection
    100445431 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100445431 (ADCY2)
Enzymes [BR:pon01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100445431 (ADCY2)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Other DBs
NCBI-GeneID: 100445431
NCBI-ProteinID: XP_024103376
LinkDB
Position
5
AA seq 1091 aa
MWQEAMRRRRYLRDRAEEAAGGGDGLPRSRDWLYESYYCMSQQHPLIVFLLLIVMGSCLA
LLAVFFALGLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSLVIWICLVAM
GYLFMCFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCLSAT
PGGKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQQ
ERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFT
RLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVK
MGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGG
VPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPR
HTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTL
RTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATALPAF
KYYVTCACLIFFCIFIVQILVLPKTSVLGISFGAAFLLLAFILFICFAGQLLQCSKKASP
LLVWLLKSSGIIANRPWPRISLTIITTAIILTMAVFNMFFLSDSEETIPPTANTTNTSFS
ASNNQLAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNTILLHT
HAHVLGDYSQVLFERPGIWKDLKTMGSVSLSIFFITLLVLGRQNEYYCRLDFLWKNKFKK
EREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFY
TESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHS
QEPERQYMHIGTMVEFAFALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDI
WGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEM
SRSLSQSNVAS
NT seq 3276 nt   +upstreamnt  +downstreamnt
atgtggcaggaggcgatgcggcgccgccgctacctgcgggaccgcgccgaggaggcggcg
ggcggcggagacgggctgccgcggtcccgggactggctctacgagtcctactactgcatg
agccagcagcacccgctcatcgtcttcctgctgctcatcgtcatgggctcctgcctcgcc
ctgctcgccgtcttcttcgcgctcgggctggaagttgaagaccatgtggcgtttctaata
acagttccaactgccctggcgattttctttgcgatatttatcctggtctgcattgagtct
gtgtttaagaagctgctgcgcctcttctcgttggtgatatggatatgccttgttgccatg
ggatacctgttcatgtgttttggaggcactgtctctccctgggaccaggtatcgttcttc
ctcttcatcatcttcgtggtgtacaccatgctacccttcaacatgcgagacgccatcatt
gccagtgtcctcacctcctcctcccacaccatcgtgcttagcgtctgcctgtctgcaaca
ccgggaggcaaggagcacctggtctggcagatcttggccaatgtgatcattttcatctgc
gggaacctggcgggagcctaccataagcacctcatggaacttgctcttcagcaaacgtat
caggacacctgtaattgcatcaagtcccggatcaagttggaatttgaaaaacgtcaacag
gagcggcttctgctctccctgctgccggcccacattgccatggagatgaaagccgagatc
atccagaggctgcagggccccaaggcgggccagatggagaacacaaataacttccacaac
ctgtacgtgaagcggcataccaacgtgagcatcttatacgctgacatcgttggctttacc
cggctggcaagtgactgctccccgggagaactagtccacatgctgaatgagctcttcgga
aagtttgatcaaattgcaaaggagaatgaatgcatgagaattaaaattttaggagactgc
tactactgtgtatctggactccctatatctctccctaaccatgccaagaactgtgtgaaa
atggggctggacatgtgtgaagccataaagaaagtgagggatgctactggagttgatatc
aacatgcgtgtgggcgtgcattctgggaatgtcctgtgtggcgtgattggtctgcagaag
tggcagtatgatgtgtggtcacatgatgtgaccttggccaaccacatggaagctggaggg
gtccctggacgtgttcacatttcttccgtcaccctggagcacttgaatggcgcttataaa
gtggaggagggagatggtgacattagggacccatatttaaaacagcacctggtgaaaacc
tactttgtaatcaaccccaagggagaacgacggagcccccagcatctcttcagacctcgc
cacaccctcgacggagccaaaatgagggcctcggtccgcatgacccggtacttggagtcc
tggggggcggccaagccctttgcacacctacatcacagggacagcatgaccacagagaac
ggcaagatcagcaccacggatgtacccatgggtcagcataattttcaaaatcgcacctta
agaaccaagtcacaaaagaagagatttgaagaagaattgaatgaaaggatgattcaagca
attgatgggattaatgcacagaagcaatggctcaagtctgaagacattcagagaatctca
ctgcttttctataacaaagtactggaaaaagagtaccgggccacggcactgccagcgttc
aagtattatgtgacttgtgcctgtctcatattcttctgcatcttcattgtgcagattctc
gtgctgccaaaaacgtccgtcctgggcatctcctttggggctgcgtttctcttgctggcc
ttcatcctcttcatctgctttgctggacagcttctgcaatgcagcaaaaaagcctctccc
ctgctcgtgtggcttttgaagtcctcgggcatcattgccaaccgcccctggccacggatc
tctctcacgatcatcaccacagccatcatattaactatggccgtgttcaacatgtttttc
ctgagtgactcagaggaaacaatccctccaacggccaatacaacaaacacaagcttttca
gcctcaaataatcagttggcgattctgcgtgcgcaaaatttatttttcctcccgtacttt
atctacagctgcattctgggactgatatcctgttccgtgttcctgcgggtaaactacgag
ctgaagatgttgatcatgatggtggccttggtgggctacaacaccatcctactccacacc
cacgcccatgtcctgggcgactacagccaggtcttatttgagagaccaggcatttggaaa
gacctgaagaccatgggctctgtgtctctctctatattcttcatcacactgcttgttctg
ggcagacagaatgaatattactgtaggttagacttcttatggaagaacaagttcaaaaaa
gagcgggaggagatagaaaccatggagaacctgaaccgcgtgctgctggagaacgtgctt
cccgcacacgtggctgagcacttcctggccaggagcctgaagaatgaggagctataccac
cagtcctatgactgcgtctgcgtcatgtttgcctccattccggatttcaaagaattttat
acagaatccgacgtgaacaaggagggcttggaatgccttcggctcctgaacgagatcatc
gctgactttgatgatcttctttccaagccaaaattcagtggagttgaaaagattaagacc
attggcagcacatacatggcagcaacaggtctgagcgctgtgcccagccaggagcactcc
caggagcccgagcggcagtacatgcacattggcaccatggtggagtttgcttttgccctg
gtagggaagctggatgccatcaacaagcactccttcaacgacttcaaattgcgagtgggt
attaaccatggacctgtgatagctggtgtgattggagctcagaagccgcaatatgatatc
tggggcaacaccgtcaatgtggccagtaggatggacagcactggagtcctggacaaaata
caggttaccgaggagacgagcctcgtcctgcagaccctcggatacacgtgcacctgtcga
ggaataatcaatgtgaaaggaaagggggacctgaagacgtactttgtaaacacagaaatg
tcaaggtccctttcccagagcaacgtggcatcctga

KEGG   Pongo abelii (Sumatran orangutan): 100449504
Entry
100449504         CDS       T01416                                 

Gene name
ADCY1
Definition
(RefSeq) adenylate cyclase type 1 isoform X1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon01100  Metabolic pathways
pon01522  Endocrine resistance
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04072  Phospholipase D signaling pathway
pon04114  Oocyte meiosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04714  Thermogenesis
pon04720  Long-term potentiation
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04727  GABAergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04921  Oxytocin signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon04976  Bile secretion
pon05032  Morphine addiction
pon05142  Chagas disease
pon05146  Amoebiasis
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100449504 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100449504 (ADCY1)
   04371 Apelin signaling pathway
    100449504 (ADCY1)
   04020 Calcium signaling pathway
    100449504 (ADCY1)
   04072 Phospholipase D signaling pathway
    100449504 (ADCY1)
   04024 cAMP signaling pathway
    100449504 (ADCY1)
   04022 cGMP-PKG signaling pathway
    100449504 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100449504 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100449504 (ADCY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100449504 (ADCY1)
   04062 Chemokine signaling pathway
    100449504 (ADCY1)
  09152 Endocrine system
   04911 Insulin secretion
    100449504 (ADCY1)
   04923 Regulation of lipolysis in adipocytes
    100449504 (ADCY1)
   04912 GnRH signaling pathway
    100449504 (ADCY1)
   04913 Ovarian steroidogenesis
    100449504 (ADCY1)
   04915 Estrogen signaling pathway
    100449504 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    100449504 (ADCY1)
   04921 Oxytocin signaling pathway
    100449504 (ADCY1)
   04926 Relaxin signaling pathway
    100449504 (ADCY1)
   04935 Growth hormone synthesis, secretion and action
    100449504 (ADCY1)
   04918 Thyroid hormone synthesis
    100449504 (ADCY1)
   04928 Parathyroid hormone synthesis, secretion and action
    100449504 (ADCY1)
   04916 Melanogenesis
    100449504 (ADCY1)
   04925 Aldosterone synthesis and secretion
    100449504 (ADCY1)
   04927 Cortisol synthesis and secretion
    100449504 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100449504 (ADCY1)
   04270 Vascular smooth muscle contraction
    100449504 (ADCY1)
  09154 Digestive system
   04970 Salivary secretion
    100449504 (ADCY1)
   04971 Gastric acid secretion
    100449504 (ADCY1)
   04972 Pancreatic secretion
    100449504 (ADCY1)
   04976 Bile secretion
    100449504 (ADCY1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100449504 (ADCY1)
   04727 GABAergic synapse
    100449504 (ADCY1)
   04725 Cholinergic synapse
    100449504 (ADCY1)
   04720 Long-term potentiation
    100449504 (ADCY1)
   04723 Retrograde endocannabinoid signaling
    100449504 (ADCY1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100449504 (ADCY1)
  09149 Aging
   04211 Longevity regulating pathway
    100449504 (ADCY1)
   04213 Longevity regulating pathway - multiple species
    100449504 (ADCY1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100449504 (ADCY1)
   04714 Thermogenesis
    100449504 (ADCY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100449504 (ADCY1)
  09165 Substance dependence
   05032 Morphine addiction
    100449504 (ADCY1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100449504 (ADCY1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100449504 (ADCY1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100449504 (ADCY1)
   05163 Human cytomegalovirus infection
    100449504 (ADCY1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100449504 (ADCY1)
   05142 Chagas disease
    100449504 (ADCY1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100449504 (ADCY1)
Enzymes [BR:pon01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100449504 (ADCY1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Other DBs
NCBI-GeneID: 100449504
NCBI-ProteinID: XP_024106091
LinkDB
Position
7
AA seq 1119 aa
MAGAPRGGGGGGGGAGEPGGAERAAGPSRRRGLRACDEEFACPELEALFRGYTLRLEQAA
TLKALAVLSLLAGALALAELLGAPGPAPGLAKGSHPVHCVLFLALLVVTNVRSLQVPQLQ
QVGQLALLFSLTFALLCCPFALGGPARGSAGAAGGPAAAEQGVWQLLLVTFVSYALLPVR
SLLAIGFGLVVAASHLLVTATLVPAKRPRLWRTLGANALLFVGVNMYGVFVRILTERSQR
KAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHD
NVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGL
TQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWS
NDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGYGHERNSFLKTHNIETFFIVPSH
RRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALR
TASEKLRNRSSFSTNVVYTTPGTRVNRYISRLLEARQTELEMADLNFFTLKYKHVEREQK
YHQLQDEYFTSAVVLTLILAALFGLVYLLIFPQSVAVLLLLVFCICFLVACVLYLHITRV
QCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWSWSSKPNSSLVVLSSGGQRTALP
TLPCESTHHALLCCLVGTLPLAIFFRVSSLPKMILLSGLTTSYILVLELSGYTRTGGGAV
SGRSYEPIVAILLFSCALALHARQVDIRLRLDYLWAAQAEEEREDMEKVKLDNRRILFNL
LPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEI
IADFDELMEKDFYKDIEKIKTIGSTYMAAVGLAPTSGTKAKKSISSHLSTLADFAIEMFD
VLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQV
TEEVHRLLRRCPYHFVCRGKVSVKGKGEMLTYFLEGRTDGNGSQIRSLGLDRKMCPYGRA
GLQGRRPPVCPMPGVSVRAGLPPHSPGQYLPSAAAGKEA
NT seq 3360 nt   +upstreamnt  +downstreamnt
atggcgggggcgccgcgcggcggaggcggcggcggaggcggcgcgggcgagcccgggggc
gccgagcgggcggccgggccaagccgccggcgcgggctccgggcgtgcgacgaggagttc
gcttgcccagaactggaggcgctgttccgtggctacacgctgcggctggagcaggcggcc
acgctgaaggcgctggccgttctcagcctgctggcgggcgcgctggcgctggcggagctg
ctgggcgcgccggggcccgcgcccggcctggccaagggctcgcacccggtgcactgcgtc
ctcttcctggcgctgctcgtggtaaccaatgtccggtccctgcaggtgccccagctgcag
caggtcggccagctggcgctgctcttcagcctcaccttcgcgctgctctgctgtcctttc
gcgctgggcggccccgcccggggttccgccggggccgctggggggccagcggccgccgaa
caaggggtttggcagctccttttggtcaccttcgtgtcctatgccttgctgcccgtgcgc
agcctgctggccatcggctttgggctcgtggtggctgcgtcgcacttgctggtcacagcc
accttggtccctgccaagcgcccacgtctctggaggacgcttggcgccaatgccttgctc
ttcgtcggtgtgaacatgtatggggtctttgtgcggattctgactgagcgttcgcagagg
aaggcgttcctgcaggcccggagctgcatcgaggaccgactgaggctggaggatgagaac
gagaagcaggagcggctgctcatgagcctcctgccccggaacgttgccatggagatgaag
gaggacttcctgaagccccctgagaggattttccacaagatttacatccagaggcatgac
aatgtgagcatcctgtttgctgacatcgtgggtttcacaggcttggcatcccagtgcaca
gcccaggagctggtgaaactcctcaatgagctctttggcaagttcgacgaattagccacg
gagaaccactgtcgccgcatcaagattcttggggactgctactactgcgtgtcgggcctc
acccagcccaagactgaccatgcccactgctgtgtggagatgggactcgacatgatagat
accatcacatccgtggctgaagccaccgaggtggacctgaacatgcgtgtgggtctgcac
acgggcagggtcctctgtggtgtcctgggcttgcgcaagtggcagtacgacgtgtggtcc
aatgatgtgaccttggccaatgtcatggaagccgctggcctgccagggaaggttcatatc
acaaagacgaccctagcgtgcttgaatggggactacgaggtagaaccaggttacggacat
gagaggaacagtttcttgaaaactcataacatcgaaaccttttttattgtgccatcccat
cgccgaaagatatttccaggcctgattctctcagatataaaaccggccaaaagaatgaag
ttcaagaccgtctgctacctgctggtgcagctcatgcactgccggaaaatgttcaaggcc
gagatccccttctccaacgtcatgacctgcgaggacgatgacaagcggagggcattaaga
acagcctcagaaaaactcagaaaccgctcatctttttctaccaacgttgtctacaccacc
ccgggcactcgcgtcaacaggtacatcagccgcctcttagaagcccgccagacagagctg
gagatggcagacctgaacttctttaccctgaagtacaaacatgtcgaacgggagcaaaag
taccaccagcttcaggacgagtatttcaccagcgccgttgtcctcaccctcatcctggct
gccttatttggccttgtctaccttctaatattcccacagagtgtggccgtcctgctcctg
ctagtattctgcatctgcttcctggtggcctgtgtcctgtacctgcacatcacccgggtc
cagtgttttccagggtgcctgacgattcagattcgcactgtcctgtgtattttcatagtg
gtcttaatctactcagtagcccaaggttgcgtggtgggctgcctgccttggtcctggagc
tccaagcccaacagttccctggtggtcctttcatctgggggccagcgcacagccctgccc
accctgccctgcgagtctactcaccatgccctgctctgctgcctggtgggcaccctcccg
ctagccatatttttccgggtgtcctccttgccaaaaatgatcctgctctccgggctcacc
acgtcctacatcctcgttctggagctcagtggatacaccaggactgggggtggtgccgtc
tccgggcgcagctacgagccgattgtggccatcctgctcttctcctgtgcgctggccctg
catgccaggcaggtggacatcaggctgaggctggactacctctgggccgcacaggcagag
gaggagcgagaggacatggagaaggtgaagctggacaacaggcgcatcctcttcaacctc
ctgccggcccacgtcgcccagcacttcctcatgtccaaccctcggaacatggacctctac
taccagtcctactcccaggtgggcgtcatgttcgcctccatccccaacttcaacgacttc
tacatcgagctggacggcaacaacatgggggtggagtgtctgcggcttctcaatgagatc
atcgccgactttgacgagctcatggaaaaagacttttacaaggacatagagaagatcaag
accatcgggagcacctacatggccgctgtggggctagcacccacctcggggaccaaagct
aagaagtccatctcctcccacctgagcacactggcggactttgccattgagatgtttgac
gttctagatgaaatcaactaccagtcttacaacgacttcgtcctccgagttggcatcaat
gttggccccgtggtggctggagtgattggcgctcgcaggccccagtacgacatctgggga
aacacagtcaacgtggccagtcggatggacagcacaggggtccagggcagaatccaggtg
actgaggaagtccaccgtctgctgagaaggtgcccctaccactttgtgtgccgaggcaaa
gtcagtgtcaagggcaaaggcgagatgttgacatattttctagaaggcaggactgatgga
aacggctcccaaatcaggtccctgggcttggatcggaaaatgtgtccatatgggagagct
ggccttcagggcagacgtcccccggtgtgccctatgcctggcgtctcagtcagggctggg
ctccctccacactccccaggccagtacctgccctctgcagcagctgggaaggaggcttag

KEGG   Pongo abelii (Sumatran orangutan): 100454138
Entry
100454138         CDS       T01416                                 

Gene name
ADCY5
Definition
(RefSeq) adenylate cyclase type 5 isoform X1
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon01100  Metabolic pathways
pon01522  Endocrine resistance
pon04015  Rap1 signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04072  Phospholipase D signaling pathway
pon04114  Oocyte meiosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04714  Thermogenesis
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04921  Oxytocin signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon04976  Bile secretion
pon05012  Parkinson disease
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05032  Morphine addiction
pon05034  Alcoholism
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100454138 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100454138 (ADCY5)
   04371 Apelin signaling pathway
    100454138 (ADCY5)
   04072 Phospholipase D signaling pathway
    100454138 (ADCY5)
   04024 cAMP signaling pathway
    100454138 (ADCY5)
   04022 cGMP-PKG signaling pathway
    100454138 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100454138 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100454138 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100454138 (ADCY5)
   04062 Chemokine signaling pathway
    100454138 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    100454138 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    100454138 (ADCY5)
   04912 GnRH signaling pathway
    100454138 (ADCY5)
   04913 Ovarian steroidogenesis
    100454138 (ADCY5)
   04915 Estrogen signaling pathway
    100454138 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    100454138 (ADCY5)
   04921 Oxytocin signaling pathway
    100454138 (ADCY5)
   04926 Relaxin signaling pathway
    100454138 (ADCY5)
   04935 Growth hormone synthesis, secretion and action
    100454138 (ADCY5)
   04918 Thyroid hormone synthesis
    100454138 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    100454138 (ADCY5)
   04916 Melanogenesis
    100454138 (ADCY5)
   04924 Renin secretion
    100454138 (ADCY5)
   04925 Aldosterone synthesis and secretion
    100454138 (ADCY5)
   04927 Cortisol synthesis and secretion
    100454138 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100454138 (ADCY5)
   04270 Vascular smooth muscle contraction
    100454138 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    100454138 (ADCY5)
   04971 Gastric acid secretion
    100454138 (ADCY5)
   04972 Pancreatic secretion
    100454138 (ADCY5)
   04976 Bile secretion
    100454138 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    100454138 (ADCY5)
   04727 GABAergic synapse
    100454138 (ADCY5)
   04725 Cholinergic synapse
    100454138 (ADCY5)
   04728 Dopaminergic synapse
    100454138 (ADCY5)
   04726 Serotonergic synapse
    100454138 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    100454138 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100454138 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    100454138 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    100454138 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100454138 (ADCY5)
   04714 Thermogenesis
    100454138 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100454138 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100454138 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    100454138 (ADCY5)
   05031 Amphetamine addiction
    100454138 (ADCY5)
   05032 Morphine addiction
    100454138 (ADCY5)
   05034 Alcoholism
    100454138 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100454138 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100454138 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100454138 (ADCY5)
   05163 Human cytomegalovirus infection
    100454138 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100454138 (ADCY5)
Enzymes [BR:pon01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100454138 (ADCY5)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD HILPDA
Other DBs
NCBI-GeneID: 100454138
NCBI-ProteinID: XP_024101137
LinkDB
Position
3
AA seq 1262 aa
MSGSKSVSPPGYAAQKTAAPAPRGGPEHRSAWGEADSRANGYPHAPGGSARGSTKKPGGA
VTPQQQQQRLASRWRSDDDDDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRRQR
RGAASGGSTRAPPAGGGGGSAAAAASAGGTEVRPRSVEVGLEERRGKGRAADELEAGAVE
DGEGSGDGGSSADSGSGAGPGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQ
SSLTMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILIMAVLCNRAAFHQDHMG
LACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSA
LHLAIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARL
HSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFT
SLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVE
MGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGG
KAGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKM
NRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEF
LGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQ
ITIVPHSVFMLSFYLTCSLLLTLVVFVSVIYSCVKLFPSPLQTLSRKIVRSKMNSTLVGV
FTIILVFLAAFVNMFTCNSRDLLGCLAQEHNISTSQVNACHVVESAINYSLGDEQGFCGS
PWPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLIVEVPGVTLFDNAD
LLVTANAIDFFNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWK
LQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIAN
FSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDST
YDKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIW
GNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPP
LS
NT seq 3789 nt   +upstreamnt  +downstreamnt
atgtccggctccaaaagcgtgagccccccgggctacgcggcgcagaagactgcggcgccg
gcgccccggggaggccccgaacaccgctcggcgtggggcgaggccgattcccgcgcgaat
ggctacccccatgcccccgggggttctgcccgcggctccaccaagaaacccgggggggcg
gtgaccccgcagcagcagcagcagcgcctggccagccgctggcgcagcgacgacgacgac
gatcctccgctaagcggtgacgaccccctggccgggggcttcggcttcagcttccgctcc
aagtccgcctggcaggagcgcggcggcgacgactgcggtcgcggcagccgccggcagcgg
cggggcgcggccagcgggggcagcacccgggcgccccctgcgggcggcggcggcggctcg
gcggcggcggctgcctcggcgggcgggacggaggtgcgccctcgctcggtggaggtgggt
ctggaggagcggcggggtaaggggcgcgcggccgacgagctggaggccggcgccgtcgag
gacggcgaggggtccggggatggcggcagctcggcggactcgggctcgggcgcggggccc
ggcgcggtgctgtccctgggcgcctgctgcctggcgttgctgcagatattccgctccaag
aagttcccgtcggacaaactggagcggctgtaccagcgctacttcttccgcctgaaccag
agcagcctcaccatgctcatggccgtgctggtgctcgtgtgcctggtcatgttggccttc
cacgcggcgcggcccccgctccagctgccctacctggccgtgctggcggccgccgtgggc
gtgatcctcatcatggctgtgctttgcaaccgcgccgccttccaccaggaccacatgggc
ctggcctgctatgcgctcatcgccgtggtgctggctgtccaggtggtgggcctgctgctg
ccgcagccgcgcagcgcctctgagggcatctggtggaccgtgttcttcatctacaccatc
tacacgctgctgcccgtgcgcatgcgggccgcagtgctcagcggggtgctcctgtccgcc
ctccacctggccatcgccctgcgcaccaacgcccaggaccagttcctgctgaagcagctt
gtctccaatgttctcattttctcctgcaccaacatcgtgggtgtctgcacccactatccg
gctgaggtctcccagagacaggctttccaggagacccgagagtgcatccaggcgcggctc
cactcgcagagggagaaccagcagcaggaacggctcctgctgtctgtccttccccgtcat
gttgccatggagatgaaagcagacatcaacgccaagcaggaggatatgatgttccataaa
atttacatccagaaacatgacaacgtgagcatcctgtttgctgacatcgagggcttcacc
agcctggcgtcccagtgcactgcacaggaactggtcatgaccctcaacgagctcttcgcc
cgctttgacaagctagccgcagagaatcactgtttacgtattaagatcctcggggattgt
tattactgcgtctcggggctgcctgaagcgagggctgaccacgctcactgctgcgtggag
atgggcatggacatgatcgaggccatctcgttggtccgggaggtgacaggggtgaacgtg
aacatgcgtgtaggaattcacagcgggcgagtacactgcggtgtccttggtctcaggaag
tggcagttcgacgtctggtctaatgatgtcacgctagccaaccacatggaggctggcggc
aaggcgggacgcatccacatcaccaaggctacactcaactacctgaatggggactacgag
gtggagccaggctgtgggggcgagcgcaacgcctacctcaaggagcacagtattgagacc
ttcctcatcctgcgctgcacccagaagcggaaagaagagaaggccatgatcgccaagatg
aaccgccagagaaccaactccatcgggcacaacccaccacactggggggctgagcgcccc
ttctacaaccacctgggtggcaaccaggtgtccaaggagatgaagcggatgggctttgaa
gaccccaaggacaagaatgcccaggagagtgcgaaccctgaggatgaagtggatgagttt
ctgggacgcgccattgacgccaggagcatcgacaggcttcggtctgagcacgtccgcaag
ttcctcctgaccttcagggagcctgacttagagaagaagtactccaagcaggtagacgac
cgatttggtgcctatgtggcgtgtgcctcgctcgtcttcctcttcatctgctttgtccag
atcaccatcgtgccccactccgtgttcatgctcagcttctacctgacctgttccctgctg
ctgaccttggtggtgtttgtgtctgtgatctactcctgcgtaaagctcttcccctcccca
ctgcagaccctctccaggaagatcgtgcggtccaagatgaacagcaccctggttggggtg
ttcaccatcatcctggtgttcctggcggcttttgtcaacatgttcacgtgcaactccagg
gacctgctgggctgcttggcacaggagcacaacatcagcacgagccaggtcaacgcatgt
cacgtggtggagtcggccatcaactacagcctgggcgatgagcagggcttctgtggcagc
ccctggcccaactgcaacttccccgagtatttcacctacagcgtgctgctcagcctgctg
gcctgctccgtgttcctgcagatcagctgcatcgggaagctggtgctcatgctggccatc
gagctcatctatgtgctcatcgtggaggtgccaggtgtcacgctcttcgacaacgccgac
ctgcttgtcaccgccaatgccatagacttcttcaacaatgggacctcccagtgccctgag
cacgcaaccaaggtggcattgaaggtggtgacgcccatcatcatctcagtctttgtgctg
gccctgtacctgcacgcccagcaggtggagtctactgctcgcctcgacttcctctggaaa
ctgcaggccacagaggagaaggaggagatggaggagctgcaggcctacaaccggcggctg
ctgcacaacatcctgcccaaggacgtggctgctcacttcctggcccgcgagcggcgcaat
gatgagctctactatcagtcctgtgagtgtgtggccgtcatgttcgcctccatcgccaac
ttctccgagttctacgttgagctggaggccaacaacgagggtgtcgaatgcctgcggcta
ctcaatgagatcatcgctgactttgatgagatcatcagcgaggatcggttccggcagctg
gagaagatcaagaccatcggcagcacctacatggccgcctccggcctcaacgattctacc
tacgacaaggtgggcaagacccacatcaaggcactggccgacttcgccatgaagctgatg
gaccagatgaagtacatcaatgagcactccttcaacaacttccagatgaagatcgggctc
aacattggccccgtggtggccggggtgataggggcacgaaagcctcagtacgacatctgg
ggcaacaccgtgaacgtggccagccgcatggacagcaccggtgtacccgaccgcatccag
gtcaccacagacatgtaccaggtgctggctgccaacacataccagctggagtgccggggc
gtggtcaaggtcaagggcaaaggcgagatgatgacctacttcctcaatggagggcccccg
ctcagttag

KEGG   Pongo abelii (Sumatran orangutan): 100460806
Entry
100460806         CDS       T01416                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon01100  Metabolic pathways
pon01522  Endocrine resistance
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04072  Phospholipase D signaling pathway
pon04114  Oocyte meiosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04714  Thermogenesis
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04727  GABAergic synapse
pon04742  Taste transduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04921  Oxytocin signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon04976  Bile secretion
pon05032  Morphine addiction
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100460806 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100460806 (ADCY4)
   04371 Apelin signaling pathway
    100460806 (ADCY4)
   04020 Calcium signaling pathway
    100460806 (ADCY4)
   04072 Phospholipase D signaling pathway
    100460806 (ADCY4)
   04024 cAMP signaling pathway
    100460806 (ADCY4)
   04022 cGMP-PKG signaling pathway
    100460806 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100460806 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100460806 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100460806 (ADCY4)
   04062 Chemokine signaling pathway
    100460806 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    100460806 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    100460806 (ADCY4)
   04912 GnRH signaling pathway
    100460806 (ADCY4)
   04913 Ovarian steroidogenesis
    100460806 (ADCY4)
   04915 Estrogen signaling pathway
    100460806 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    100460806 (ADCY4)
   04921 Oxytocin signaling pathway
    100460806 (ADCY4)
   04926 Relaxin signaling pathway
    100460806 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    100460806 (ADCY4)
   04918 Thyroid hormone synthesis
    100460806 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    100460806 (ADCY4)
   04916 Melanogenesis
    100460806 (ADCY4)
   04925 Aldosterone synthesis and secretion
    100460806 (ADCY4)
   04927 Cortisol synthesis and secretion
    100460806 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100460806 (ADCY4)
   04270 Vascular smooth muscle contraction
    100460806 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    100460806 (ADCY4)
   04971 Gastric acid secretion
    100460806 (ADCY4)
   04972 Pancreatic secretion
    100460806 (ADCY4)
   04976 Bile secretion
    100460806 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100460806 (ADCY4)
   04727 GABAergic synapse
    100460806 (ADCY4)
   04725 Cholinergic synapse
    100460806 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    100460806 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    100460806 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    100460806 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    100460806 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    100460806 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100460806 (ADCY4)
   04714 Thermogenesis
    100460806 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460806 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    100460806 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100460806 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100460806 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100460806 (ADCY4)
   05163 Human cytomegalovirus infection
    100460806 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100460806 (ADCY4)
Enzymes [BR:pon01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100460806 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 100460806
NCBI-ProteinID: XP_009247254
Ensembl: ENSPPYG00000005702
LinkDB
Position
14
AA seq 883 aa
MERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMKAEIMARLQAGQGSR
PESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNELFGKFDQIAKEHEC
MRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATGVDINMRVGVHSGSV
LCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAGAYAVEDAGMEHRDP
YLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGLKMRPSLLMTRYLESWGAAKPFAHL
SHGDSPVSTSTPLPEKTLASFSPQWSLDRSRTPRGLDDELDTGDAKFFQVIEQLNSQKQW
KQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFIIQMLVTNRPPALAI
TYSITFLLFLLILFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRPGLRIALGTATILLV
FAMAITSLFFFPTSSDCPFQAPNVSSMISNLSWELPGSLPLISVPYSMHCCTLGFLSCSL
FLHMSFELKLLLLLLWLAASCSLFLHSHAWLSECLIVRLYLGPLDSRPGVLKEPKLMGAI
SFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRLLLENVLPAHVAPQF
IGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIADFDELLS
KPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMVEFAVALGSKLDIIN
KHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETAW
ALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 2652 nt   +upstreamnt  +downstreamnt
atggagcgcgccctgcgggccacgttccgggaggcactcagctccctgcactcacgccgg
cggctggacaccgagaagaagcaccaggaacaccttctcttatccatccttcctgcctac
ctggcccgagagatgaaggcagagatcatggcacggctgcaggcaggacaggggtcacgg
ccagagagcaccaacaatttccacagcctctatgtcaagaggcaccagggagtcagcgtg
ctgtatgctgacatcgtgggcttcacacggctggccagcgagtgttcccctaaggagctg
gtgctcatgctcaatgagctctttggcaagttcgaccagatcgccaaggagcatgaatgc
atgcggatcaagatcctgggggactgttactactgtgtctccgggctgccactctcactg
ccagaccatgccatcaactgcgtgcgcatggggctggacatgtgccgggccatcaggaaa
ctgcgggcagctactggcgtggacatcaacatgcgtgtgggcgtgcactcaggcagcgta
ctgtgtggagtcatcgggctgcagaagtggcagtacgacgtttggtcccatgatgtcaca
ctggctaaccacatggaggcaggcggtgtaccagggcgagtgcacatcacaggggctacc
ctggccctgctggcaggggcttatgctgtggaggacgcaggcatggagcatcgggaccct
taccttcgggagctaggggagcctacctatctggtcatcgatccacgggcagaggaggag
gatgagaagggcactgcaggaggcttgctgtcctcgcttgagggcctcaagatgcgtcca
tcactgctgatgacccgttacctggagtcctggggcgcagccaagccttttgcccacctg
agccacggagacagccctgtgtccacctccacccctctcccggagaagaccctggcttcc
ttcagcccccagtggagcctggatcggagccgtaccccccggggactagatgatgaactg
gacaccggggatgccaagttcttccaggtcattgagcagctcaactcgcagaaacagtgg
aagcagtcgaaggacttcaacccactgacactgtacttcagagagaaggagatggagaaa
gagtaccgactctctgcaatccccgccttcaaatactatgaagcttgcaccttcctggtt
tttctctccaacttcatcatccagatgctagtgacaaacaggcccccagctctggcgatc
acgtatagcatcaccttcctcctcttcctcctcatcctttttgtctgcttctcagaggac
ctgatgaggtgtgtcctgaaaggccccaagatgctgcactggctgcctgcactgtctggc
ctggtggccacacgaccaggactgagaatagccttgggcaccgccaccatcctccttgtc
tttgccatggccattaccagcctgttcttcttcccaacatcatcagactgccctttccaa
gctcccaatgtgtcctccatgatttccaacctctcctgggagctccctgggtctctgcct
ctcatcagtgtcccatactccatgcactgctgcacactgggcttcctctcctgctccctg
tttctgcacatgagcttcgagctgaagctgctgctgctcctgctgtggctggcggcatcc
tgctccctcttcctgcactcccacgcctggctgtctgaatgtctcatcgtccgcctctat
ctgggccccttggactccaggcccggagtgctgaaggagcccaaactgatgggtgctatc
tccttcttcatcttcttcttcaccctccttgtcctggctcgccagaatgagtactactgc
cgcctggacttcctgtggaagaagaagctgaggcaggagcgggaggagacagagacgatg
gagaacctgactcggctgctcttggagaacgtgctccctgcacacgtggccccccagttc
attggccagaaccggcgcaacgaggatctctaccaccagtcctacgaatgcgtttgtgtc
ctcttcgcctcagtcccagacttcaaggagttctactctgaatccaacatcaatcatgag
ggcctagagtgtctgaggctgctcaatgagataattgctgattttgatgagctgctctcc
aagcccaagttcagtggggtggagaagatcaagaccatcggcagcacctacatggcagcc
acaggcttaaatgccacctctggacaggatgcacaacaggatgctgaacggagctgcagc
caccttggcactatggtggaatttgccgtggccctggggtctaagctggacatcatcaac
aagcattcattcaacaacttccgcctgcgtgtggggttgaaccatggaccagtagtagct
ggagttattggggcccagaagccgcaatatgacatttggggcaacacagtgaacgtggcc
agccgcatggagagtacaggagtccttggcaaaatccaagtgactgaggagacagcatgg
gccctacagtccctgggctacacctgctacagccggggtgtcatcaaggtgaaaggcaaa
gggcagctctgcacctacttcctgaacacagacttgacacgaactggacctccttcagct
accctaggctga

KEGG   Pongo abelii (Sumatran orangutan): 100461383
Entry
100461383         CDS       T01416                                 

Gene name
ADCY8
Definition
(RefSeq) adenylate cyclase type 8 isoform X1
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon01100  Metabolic pathways
pon01522  Endocrine resistance
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04072  Phospholipase D signaling pathway
pon04114  Oocyte meiosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04714  Thermogenesis
pon04720  Long-term potentiation
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04727  GABAergic synapse
pon04742  Taste transduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04921  Oxytocin signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon04976  Bile secretion
pon05032  Morphine addiction
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100461383 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100461383 (ADCY8)
   04371 Apelin signaling pathway
    100461383 (ADCY8)
   04020 Calcium signaling pathway
    100461383 (ADCY8)
   04072 Phospholipase D signaling pathway
    100461383 (ADCY8)
   04024 cAMP signaling pathway
    100461383 (ADCY8)
   04022 cGMP-PKG signaling pathway
    100461383 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100461383 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100461383 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100461383 (ADCY8)
   04062 Chemokine signaling pathway
    100461383 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    100461383 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    100461383 (ADCY8)
   04912 GnRH signaling pathway
    100461383 (ADCY8)
   04913 Ovarian steroidogenesis
    100461383 (ADCY8)
   04915 Estrogen signaling pathway
    100461383 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    100461383 (ADCY8)
   04921 Oxytocin signaling pathway
    100461383 (ADCY8)
   04926 Relaxin signaling pathway
    100461383 (ADCY8)
   04935 Growth hormone synthesis, secretion and action
    100461383 (ADCY8)
   04918 Thyroid hormone synthesis
    100461383 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    100461383 (ADCY8)
   04916 Melanogenesis
    100461383 (ADCY8)
   04925 Aldosterone synthesis and secretion
    100461383 (ADCY8)
   04927 Cortisol synthesis and secretion
    100461383 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100461383 (ADCY8)
   04270 Vascular smooth muscle contraction
    100461383 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    100461383 (ADCY8)
   04971 Gastric acid secretion
    100461383 (ADCY8)
   04972 Pancreatic secretion
    100461383 (ADCY8)
   04976 Bile secretion
    100461383 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    100461383 (ADCY8)
   04727 GABAergic synapse
    100461383 (ADCY8)
   04725 Cholinergic synapse
    100461383 (ADCY8)
   04720 Long-term potentiation
    100461383 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    100461383 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    100461383 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    100461383 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    100461383 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    100461383 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100461383 (ADCY8)
   04714 Thermogenesis
    100461383 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100461383 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    100461383 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100461383 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100461383 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100461383 (ADCY8)
   05163 Human cytomegalovirus infection
    100461383 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100461383 (ADCY8)
Enzymes [BR:pon01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100461383 (ADCY8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Other DBs
NCBI-GeneID: 100461383
NCBI-ProteinID: XP_024106977
LinkDB
Position
8
AA seq 1251 aa
MELSDVRCLTGSEELYTIHPTPPAGDGRSASRPQRLLWQTAVRHITEQRFIHGHRGGSGS
GSGGSGKASDPAGGGPNHHAPQLSGDSALPLYSLGPGERAHSTCGTKVFPERSGSGSASG
SGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRK
SEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSHT
YLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTS
LLQVILQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEAR
LRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADV
KGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAH
CCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKL
ESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPED
IVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHV
QSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAF
IVLLFITAIQSLLPSSRVMPMTIQFSILIMLHSALVLITTAEDYKCLPLILRKTCCWINE
TYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTG
VLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETIYAGLFLRYDNLNHSGEDFLGTKEA
SLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVA
RHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDE
LLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKH
SFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLIL
KDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLV
QSLNRQRQKQLLNENNNTGIIKGHYNRRTLLSPNGTEPGAQAEGTDKSDLP
NT seq 3756 nt   +upstreamnt  +downstreamnt
atggagctctccgatgtgcgctgccttacaggcagcgaggaactctacaccattcacccg
acgcccccggccggcgacggcaggagcgcctcccggccgcagcggctgctgtggcagacg
gcggtgcgacacatcacggagcagcgcttcattcacgggcaccggggaggcagcggcagc
gggagtggaggctcgggcaaagcctcggaccctgcgggcggcggccccaaccaccacgcg
ccgcagctgtcaggcgactcggcgctgcccctctactcgctgggcccgggagagcgagcg
cacagcacctgcggcaccaaagtcttcccggaacgcagcgggagcggcagtgccagcggc
agcggaggcggaggcgacctgggcttcctgcacctggactgtgcccctagcaactcggat
ttctttctcaatgggggctatagctaccgaggggtcattttccccaccctgcgcaactcc
ttcaaatctcgggatctggaacgcctctaccagcgctatttcttgggccaaaggcgcaaa
tcggaagtggtgatgaacgtgctggacgtgctgaccaaactcactctcttggtcctacac
ttgagcctggcctcagcccccatggacccgctcaagggcatcctgctgggcttcttcacc
ggcattgaggtggtgatctgcgccctggtggtggtccggaaggacaccacctcccacacg
tacctgcagtacagcggtgtggtcacctgggtggccatgaccacccagatcctggcagca
ggcctcggctacgggctcctgggcgacggcataggctacgtgctcttcacgctcttcgcc
acctacagtatgctgccgctgccgctcacctgggccatcctggccggcctgggcacctcg
ctgctgcaggtcatcctccaagtggtcatcccccgcctggcggtcatttccatcaaccag
gttgtggctcaggcagtgttattcatgtgtatgaacacagctggaatcttcatcagttac
ctgtcagaccgggcccagcgccaagctttcctggagactcggaggtgtgtggaggccagg
ctgcgcctggagacagagaaccaaagacaggagcggctagtgctttctgtgcttccccgg
tttgttgtcctggaaatgatcaacgacatgaccaatgtggaagatgagcacctgcagcac
cagttccatcggatctacatccatcgctatgagaacgtcagtattctttttgcagatgtt
aaaggatttaccaacctctccacgaccttgtctgctcaggagctggtcaggatgctcaac
gagctctttgccagatttgatcgactggcccatgagcatcactgccttcgtattaaaatc
ctgggggactgctactactgcgtgtctggacttcctgagccccgccaggaccatgcccac
tgctgtgttgaaatgggtctcagcatgatcaaaaccatcaggtatgtgcggtcaaggaca
aaacacgatgttgacatgaggattggaatccactcaggctcagtgctgtgcggtgttttg
ggactaaggaagtggcagtttgatgtctggtcttgggatgtggatattgcaaacaaactc
gaatctggaggaatccccgggaggattcacatttccaaagccacgctggactgtctcaac
ggtgactacaacgtggaagagggtcatggtaaagagaggaatgaattcctgaggaagcat
aatatcgagacttacttaattaagcagcctgaggacagtctgctgtccttgcctgaagat
atcgtcaaggagtcagtgagctcctcagaccggagaaacagtggggccacattcactgaa
ggatcctggagccctgaactgccctttgataatatcgtggggaaacagaatactctggct
gccctaacaagaaattcaataaatctgcttccaaaccatcttgcacaagctttgcatgtc
cagtctgggcctgaggaaattaacaagagaatagaacataccatcgacttgcggagtggc
gataaattgagaagagagcatatcaagccattctcactgatgtttaaagactccagcctg
gagcacaagtattctcaaatgagggatgaagtgttcaagtcaaacttggtctgtgcattt
atcgttcttctatttatcacggcaatacaaagtttgcttccttcttcaagagtgatgcca
atgaccatccagttctccattctgattatgctgcactcagctctggtcctcatcaccaca
gcagaggattataagtgtttgcccctcatcctccggaaaacttgctgttggattaatgag
acctatttggcccggaacgtcatcatctttgcatccatcttgattaatttcctgggtgcc
atcttaaatatcctgtggtgtgattttgacaagtcgatacccttgaagaacctgactttc
aattcctcagctgtgtttacagatatctgctcctacccagagtactttgtcttcacgggg
gtgttggccatggtgacctgtgcagttttcctccggctgaactccgtcctgaagctggca
gtgctgctgataatgatcgccatctatgccctgctcactgagaccatctatgcaggcctc
tttctgcgttatgacaacctcaaccacagtggagaagatttcctggggaccaaggaggca
tcgctgctactgatggccatgttcctcctggctgtgttctaccatggacagcagctggag
tacacagcccgcctggacttcctttggcgagtacaggccaaagaggagatcaatgagatg
aaggagctgagggaacacaatgagaacatgctccggaatatcttacccagccacgtggcc
cgccatttcctagagaaggaccgagacaatgaggagctgtattctcaatcctatgatgct
gttggggtgatgtttgcctccatcccaggatttgcagacttttactctcagactgaaatg
aataaccagggagtggaatgcctgcgcttgctgaatgagatcattgctgacttcgatgag
ttgcttggtgaagaccgatttcaagacattgaaaagattaagaccattggtagcacctac
atggccgtgtcaggcctgtcacctgaaaaacagcaatgtgaagacaagtggggacatttg
tgtgctctggctgacttctcactcgccctgactgaaagcatacaggagatcaacaagcat
tcattcaacaattttgaactccggattggcatcagccacggctcagtggtagctggcgtt
atcggcgctaagaaaccacagtatgacatttgggggaaaactgtgaacctggcaagccga
atggacagcacgggggttagtggccggatccaagtcccagaggagacctatctcatcctg
aaggaccagggctttgcctttgattaccgaggggagatttatgtgaagggcatcagtgaa
caggaaggaaaaatcaaaacgtactttctcctgggaagagtccaacccaacccattcatc
ttgcccccaagaagattgcctgggcagtactccttggctgcggttgtcctgggacttgtc
cagtccctcaataggcaaaggcagaagcagctactcaatgagaacaacaacacgggaatc
atcaagggtcattacaaccggcggactttgttgtcacccaacgggacggagcctggagcc
caagctgaaggcaccgacaaatctgatttgccataa

KEGG   Pongo abelii (Sumatran orangutan): 103889530
Entry
103889530         CDS       T01416                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase type 9 isoform X1
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon01100  Metabolic pathways
pon01522  Endocrine resistance
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04072  Phospholipase D signaling pathway
pon04114  Oocyte meiosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04714  Thermogenesis
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04727  GABAergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04921  Oxytocin signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04961  Endocrine and other factor-regulated calcium reabsorption
pon04962  Vasopressin-regulated water reabsorption
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon04976  Bile secretion
pon05032  Morphine addiction
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103889530 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103889530 (ADCY9)
   04371 Apelin signaling pathway
    103889530 (ADCY9)
   04020 Calcium signaling pathway
    103889530 (ADCY9)
   04072 Phospholipase D signaling pathway
    103889530 (ADCY9)
   04024 cAMP signaling pathway
    103889530 (ADCY9)
   04022 cGMP-PKG signaling pathway
    103889530 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103889530 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103889530 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103889530 (ADCY9)
   04062 Chemokine signaling pathway
    103889530 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    103889530 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    103889530 (ADCY9)
   04912 GnRH signaling pathway
    103889530 (ADCY9)
   04913 Ovarian steroidogenesis
    103889530 (ADCY9)
   04915 Estrogen signaling pathway
    103889530 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    103889530 (ADCY9)
   04921 Oxytocin signaling pathway
    103889530 (ADCY9)
   04926 Relaxin signaling pathway
    103889530 (ADCY9)
   04935 Growth hormone synthesis, secretion and action
    103889530 (ADCY9)
   04918 Thyroid hormone synthesis
    103889530 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    103889530 (ADCY9)
   04916 Melanogenesis
    103889530 (ADCY9)
   04925 Aldosterone synthesis and secretion
    103889530 (ADCY9)
   04927 Cortisol synthesis and secretion
    103889530 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103889530 (ADCY9)
   04270 Vascular smooth muscle contraction
    103889530 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    103889530 (ADCY9)
   04971 Gastric acid secretion
    103889530 (ADCY9)
   04972 Pancreatic secretion
    103889530 (ADCY9)
   04976 Bile secretion
    103889530 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103889530 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103889530 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    103889530 (ADCY9)
   04727 GABAergic synapse
    103889530 (ADCY9)
   04725 Cholinergic synapse
    103889530 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    103889530 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103889530 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    103889530 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    103889530 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103889530 (ADCY9)
   04714 Thermogenesis
    103889530 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103889530 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    103889530 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103889530 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103889530 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103889530 (ADCY9)
   05163 Human cytomegalovirus infection
    103889530 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103889530 (ADCY9)
Enzymes [BR:pon01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103889530 (ADCY9)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 DUF512 zf-C2HC_2 AC_N
Other DBs
NCBI-GeneID: 103889530
NCBI-ProteinID: XP_024089615
LinkDB
Position
16
AA seq 1372 aa
MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDS
GGVPRRVGGGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYAL
FYIGFACLLWSIYFAVHMRSRLIVMVAPALCFLLVCVGFFLFTFTKLYARHYAWTSLALT
LLVFALTLAAQFQVLTPVSGRGDSSNLTTTAQPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLCMGVAYSVLFETFGYHFRDEACFPSPGAGALHWELLSRALLHGCIHAIGVHLFV
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HAASSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVIERLGQSVVADQLKGLKTYLISGQRAKESRCSCAEALLSGFEVIDGSQVS
SGPRGQGTASSGNVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGTKGGAPQNGCQDEHKN
STKVTSSWLLFLSVPLLAHPPKASGGPNPKTQNGLLSPPQEEKLTNSQTSLCEILQEKGR
WAGVSLDQSALLPLRFKNIREKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELER
SYRTSYQEEVIKNSPVKTFASPTFSSLLDVFLSTTVFLTLSITCFLKYEAATTPPPPAAL
AVFSAALLLEVLSLAVSIRMVFFLEDVMACTKHLLEWIAGWLPRHCIGAILVSLPALAVY
SHVTSEYETNIHFPVFTGSAALIAVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYVSLCP
DSSVLTSPLDTVQNFSSERNPCNSSVPRDLRPPASLIGQEVVLVFFLLLLLVWFLNREFE
VSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIF
ASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLN
TAQAQDGSHPQEHLQILFEFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTK
LLYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYL
YPKCTDHGVIPQHQLSISPDIRVQVDGSIGRSPTDEIANLVPSVQYVDKISLGSDSSTQA
KDAHLSPKRPWKEPVKAEERGRFGKAIEKDDCDETGIEEANELTKLNVSKSV
NT seq 4119 nt   +upstreamnt  +downstreamnt
atggcttccccgccccaccagcagctgctgcatcaccacagcaccgaggtgagctgcgac
tccagcggggacagcaacagcgtgcgcgtcaagatcaaccccaagcagctgtcctccaac
agccaccccaagcactgcaaatacagcatctcctccagctgcagcagctctggggactcc
gggggcgtcccccggcgagtgggcggcggaggccggctgcgcaggcagaagaagctgccc
cagctgttcgagagggcctccagccgctggtgggaccccaagttcgactcggtgaacctg
gaggaggcctgcctggagcgctgcttcccgcagacccagcgccggttccggtatgcactc
ttctacatcggcttcgcctgccttctgtggagcatctattttgcggtccacatgagatcc
agactgatcgtcatggtcgcccccgcgctgtgcttcctcttggtgtgtgtgggcttcttt
ctgtttaccttcaccaagctgtacgcccggcattacgcgtggacctcgctggctctcacc
ctgctggtgttcgccctgaccctggctgcgcagttccaggtcttgacgcctgtctcagga
cgcggcgacagctccaaccttacgaccacagcccagcccacagatacttgcttatctcaa
gtggggagcttctccatgtgcattgaagtgctctttttgctctataccgtcatgcactta
cctttgtacctgagcttgtgtatgggggtggcctactctgtccttttcgagacctttggc
taccatttccgggatgaagcctgcttcccctcgcccggagctggggccctgcactgggag
ctgctgagcagggcgctgctgcacggctgcatccacgccatcggggtccacctgttcgtc
atgtcccaggtgaggtccaggagcactttcctcaaggtagggcaatccattatgcacggg
aaggacctggaagtggaaaaagccctcaaagagagaatgattcattccgtgatgccaaga
atcatagccgatgacttaatgaagcagggggatgaggagagtgagaattctgtcaagagg
catgccgcctcgagccccaagaacaggaagaaaaagtcttccatccaaaaagctcctatc
gccttccgcccttttaagatgcagcagatcgaagaagtaagtattttatttgcagatatc
gtgggcttcaccaagatgagtgccaacaagtccgcccacgccctggtgggtctcctgaat
gatctgttcggtcgcttcgaccgcctgtgtgaggagaccaagtgtgagaaaatcagcact
ctgggagactgttactattgcgtggcgggctgtcccgagccccgggccgaccatgcctac
tgctgcatcgagatgggcctgggcatgatcaaggccatcgagcagttctgccaggagaag
aaggagatggtgaacatgagagtcggggtgcacacgggcaccgtcctgtgcggcatcctg
ggcatgaggaggtttaaatttgacgtgtggtccaacgatgtgaacctggccaatctcatg
gagcagctgggagtggccggcaaagttcacatttctgaggccaccgcaaaatacttagat
gaccggtacgaaatggaagatgggaaagttatcgaacggctgggccagagcgtggttgct
gaccagttgaaaggtttgaagacatacctgatatcgggtcagagagccaaggagtctcgc
tgcagctgtgcagaggccttgctttctggctttgaggtcattgacggctcacaggtgtcc
tcaggccctaggggacaggggacagcgtcatcagggaatgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgcccttcgtgcggaatcacatttgctcccaaa
tctgaagccggcaccaagggaggagcacctcaaaacggctgccaagacgagcataaaaac
agcaccaaggtaacaagctcatggctgttgttcctgtcagttcctctcctggcgcatcca
cccaaggcttctggaggacctaatcccaaaactcagaacgggctcctgagccctccccaa
gaggagaagctcaccaacagtcagacctctctgtgtgagatcttacaagagaagggaagg
tgggcaggggtgagcctggaccagtcggctctccttccgctgaggttcaagaacatccgg
gagaaaacggacgcccactttgtggacgttatcaaagaagacagcctgatgaaagattat
ttttttaagccgcccattaatcagttcagcctgaacttcctggatcaggagctggagcga
tcctacaggaccagctatcaagaagaggtgataaagaactcccccgtgaagacgtttgct
agtcccaccttcagctccctcctggatgtgtttctgtcgaccacagtgtttctgacgctg
tccatcacctgcttcctgaagtacgaggcggccaccacgcctcccccgcccgctgccctg
gcggtcttcagcgcggccctgctgctggaggtgctgtccctcgcggtgtccatcaggatg
gtgttcttcctggaggacgtcatggcctgcaccaagcacctgctggagtggatcgctggc
tggctaccacgtcactgcatcggggccatcctggtgtcgctccccgcactggccgtctac
tcccatgtcacctccgaatatgagacaaacatacacttcccagtgttcacaggctcggcc
gctctgattgccgtcgtgcactactgtaacttctgccagctcagctcctggatgaggtcc
tccctcgccaccgtcgtgggggccgggccgctgctcctgctctacgtctccctgtgccca
gacagttctgtattaacttcaccccttgacacagtacagaatttcagttccgagaggaac
ccgtgcaatagctcggtgccgcgtgacctccggccgccggccagcctcatcggccaggag
gtggttctcgtcttctttctcctgctcttgttggtctggttcctgaatcgcgaatttgaa
gtcagctaccgcctccactaccacggagacgtggaagcggatcttcaccgcaccaagatc
cagagcatgcgggaccaggcagactggctgctgaggaacatcatcccctaccacgtggct
gagcagctgaaggtgtcccagacctactccaagaaccacgacagcggaggggtgatcttc
gccagcatcgtcaacttcagcgagttctacgaggagaactacgagggcggcaaggagtgc
taccgggtcctcaatgagctcatcggggactttgacgagctcctaagcaagccggactac
agcagcatcgagaagatcaagaccatcggagccacgtacatggcagcgtcagggctgaac
accgcgcaggcccaggacggcagccacccacaggagcacctgcagatcctgttcgagttc
gccaaggagatgatgcgcgtggtggacgacttcaacaacaacatgctgtggttcaacttc
aagctccgcgttggcttcaaccatggacccctcacggccggggtcatcggcaccaccaag
ctgctgtacgacatctggggagacaccgtcaacatcgccagcaggatggacaccaccggc
gtggagtgccgcatccaggtgagtgaagagagctaccgcgtcttgagcaagatgggctat
gacttcgactacagagggaccgtgaatgtcaaggggaaaggccagatgaagacctacctg
tacccaaagtgcacggaccacggggtcatcccacagcaccagctgtccatctccccagac
atccgtgtccaggtggacggcagcatcggacggtctcccacagacgagattgccaacctg
gtgccttctgtccagtatgtggacaagatatctctgggttctgacagcagtacgcaggcc
aaggacgcccacctgtcccccaagagaccctggaaggagcccgtcaaagccgaagaaagg
ggccgatttggcaaagccatagagaaagacgactgtgacgaaacaggaatagaagaagcc
aacgaactcaccaagctcaacgtttcaaagagtgtgtga

DBGET integrated database retrieval system