KEGG   Pongo abelii (Sumatran orangutan): 100431225
Entry
100431225         CDS       T01416                                 

Gene name
RALBP1
Definition
(RefSeq) ralA-binding protein 1 isoform X1
  KO
K08773  RalA-binding protein 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon05200  Pathways in cancer
pon05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100431225 (RALBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100431225 (RALBP1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100431225 (RALBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100431225 (RALBP1)
Membrane trafficking [BR:pon04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    100431225 (RALBP1)
SSDB
Motif
Pfam: RhoGAP Nod1
Other DBs
NCBI-GeneID: 100431225
NCBI-ProteinID: XP_024091566
Ensembl: ENSPPYG00000009010
LinkDB
Position
18
AA seq 655 aa
MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDTLHEPPDV
VSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKK
KEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQ
IDVPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKV
DELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTEAEKV
QEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVF
FTHVQELFGNVVLKQVMKPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGI
KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVIN
ILLAQENEILTEQEELLAMEQFLRRQIASEKEEIERLRAEIAEIQSRQQHGRSETEEYSS
ESESESEDEEELQIILEDLQRQNEELEIKNNHLNQAIHEEREAIIELRVQLRLLQMQRAK
AEQQAQEDEEPEWRGGAVQPPRDGVLEPKAAKEQPKAGKEPAKPSPSRDRKETSI
NT seq 1968 nt   +upstreamnt  +downstreamnt
atgactgagtgcttcctgccccccaccagcagccccagtgaacaccgcagggtggagcat
ggcagcgggcttacccggacccccagctctgaagagatcagccctactaagtttcctgga
ttgtaccgcactggcgagccctcgcctccccatgacaccctccatgagcctcctgatgta
gtgtctgatgatgagaaagaccatgggaagaaaaaagggaaatttaagaaaaaggaaaag
aggactgaaggctatgcagcctttcaggaagatagctctggagatgaggcagaaagtcct
tctaaaatgaagaggtccaagggaatccatgttttcaagaagcccagcttttctaaaaag
aaggaaaaggattttaaaataaaagagaaacccaaagaagaaaagcataaagaagaaaag
cacaaagaagaaaaacataaagagaagaagtcgaaagacttgacagcagctgatgttgtt
aaacagtggaaggaaaagaagaaaaagaaaaagccaattcaggagccagaggtgcctcag
attgatgttccaaatctcaaacccatttttggaattcctttggctgatgcagtagagagg
accatgatgtatgatggcattcggctgccagccgttttccgtgaatgtatagattacgta
gagaagtatggcatgaagtgtgaaggcatctacagagtatcaggaattaaatcaaaggtg
gatgagctaaaagcagcctatgaccgggaggagtctacaaacttggaagactatgagcct
aacactgtagccagtttgctgaagcagtatttgcgagaccttccagagaatttgcttacc
aaagagcttatgcccagatttgaagaggcttgtgggaggaccacggaggctgagaaagtg
caggaattccagcgtttactcaaagaactgccagaatgtaactatcttctgatttcttgg
ctcattgtgcacatggaccatgtcatcgcaaaggaactggaaacaaaaatgaatatacag
aacatttctatagtgctcagcccaactgtgcagatcagcaatcgagtcctgtatgtgttt
ttcacacatgtgcaagaactctttggaaatgtggtactaaagcaagtgatgaaacctctg
cgatggtctaacatggccacgatgcccacgctgccagagacccaggcgggcatcaaggag
gagatcaggagacaggagtttcttttgaattgtttacatcgagatctgcagggtggaata
aaggatttgtctaaagaagaaagattatgggaagtacaaagaattttgacagccctcaaa
agaaaactgagagaagctaaaagacaggagtgtgaaaccaagattgcacaagagatagcc
agtctttcaaaagaggatgtttccaaagaagagatgaatgaaaatgaagaagttataaat
attctccttgctcaggagaatgagatcctgactgaacaggaggagctcctggccatggag
cagtttctgcgccggcagattgcctcagaaaaagaagagattgaacgcctcagagctgag
attgctgaaattcagagtcgccagcagcacggccgaagtgagactgaggagtactcctcc
gagagcgagagcgagagtgaggatgaggaggagctgcagatcattctggaagacttacag
agacagaatgaagagctggaaataaagaacaatcatttgaatcaagcaattcatgaggag
cgcgaggccatcatcgagctgcgcgtgcagctgcggctgctccagatgcagcgagccaag
gccgagcagcaggcgcaggaggatgaggagcctgagtggcgcgggggtgccgtccagccg
cccagagacggcgtcctcgagccaaaagcagctaaagagcagccaaaggcaggcaaggag
ccggcaaagccatcgcccagcagggataggaaggagacgtccatctga

DBGET integrated database retrieval system