KEGG   Pongo abelii (Sumatran orangutan): 100431300Help
Entry
100431300         CDS       T01416                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7 isoform X1
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05034  Alcoholism
pon05165  Human papillomavirus infection
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    100431300 (HDAC7)
  09164 Substance dependence
   05034 Alcoholism
    100431300 (HDAC7)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    100431300 (HDAC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100431300 (HDAC7)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100431300 (HDAC7)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100431300 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100431300
NCBI-ProteinID: XP_024112951
Ensembl: ENSPPYG00000004446
LinkDB All DBs
Position
12
AA seq 991 aa AA seqDB search
MHSPGADGTQVSPGAHYCSPTGTGCPRPCADTPGPQLQPMDLRVGQRPPVEPPPEPTLLA
LQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVGPQEQELRQLLHKDKSKRSAVA
SSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPLETEGATRSMLSSFLPPVPSLP
SDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPGS
SSTPASGCSSPNDSEHGPNPILGSEALLGQRLRLQETSVAPFALPTVSLLPAITLGLPAP
ARADGDRRTHPTLGPRGPILGSPHTPLFLPHGLEPEAGGTLPSRLQPILLLDPSGSHAPL
LTVPGLGPLPFHFAQSLMTTERLSGSGLHWPLSRTRSEPLPPSATAPPPPGPMQPRLEQL
KTHVQVIKRSAKPSEKPRLRQIPSAEDLETDGGGPGQVVDDGLEHRELGHGQPEARGPAP
LQQHPQVLLWEQQRLAGRLPRGSTGDTVLLPLAQGGHRPLSRAQSSPAAPASLSAPEPAS
QARVLSSSETPARTLPFTTGLIYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQERGLR
SQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLPCGGV
GVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCF
FNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQTFYQDPSVLYISLHRHDDGNFFPGS
GAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRIVVMPIAREFSPDLVLVSAGFD
AAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLALEGGHDLTAICDASEACVAALLG
NKVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQRLASCPDSWVPRVPGADKEEVE
AVTALASLSVGILAEDRPSEQLVEEEEPMNL
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgcacagccccggcgctgatgggacccaggtgagcccgggtgcccactactgcagcccc
actggcacaggctgccccaggccctgtgcagacacaccaggccctcagctgcagcccatg
gacctgcgggtgggccagcggcccccagtggagcccccaccagagcccacattgctggcc
ctgcagcgtccccagcgcctgcaccaccacctcttcctagcaggcctgcagcagcagcgc
tcggtggagcccatgaggctctccatggacacgccgatgcctgagttgcaggtgggaccc
caggaacaagagctgcggcagcttctccacaaggacaagagcaagcgaagtgctgtagcc
agcagtgtggtcaaacagaagctggcagaggtgattctgaaaaagcagcaggcggcccta
gaaagaacagtccaccccaacagccccggcattccctacagaactctggagcccctggag
acggaaggagccacccgctccatgctcagcagctttttgcctcctgttcccagcctgccc
agtgaccctccagagcacttccctctgcgcaagacagtctctgagcccaacctgaagctg
cgctataagcccaagaagtccctggagcggaggaagaatccactgctccgaaaggagagt
gcgccccccagcctccggcggcggcccgcagagaccctcggagactcctccccaggtagt
agcagcacgcccgcgtcagggtgcagctcccccaatgacagcgagcacggccccaatccc
atcctgggctcggaggcgctcttgggccagcggctgcggctgcaggagacttctgtggcc
ccgttcgccttgccgacagtgtccttgctgcccgcaatcactctggggctgcccgcccct
gccagggctgacggtgaccgcaggacccatccgactctgggccctcgggggccaatcctg
gggagcccccacactcccctcttcctgccccatggcctggagcccgaggctgggggcacc
ttgccttctcgcctgcagcccattctcctcctggacccctcaggctctcatgccccgctg
ctgactgtgcccgggcttgggcccttgcccttccactttgcccagtccttaatgaccacc
gagcggctctctgggtcaggcctccactggccactgagccggactcgctcagagcccctg
ccccccagtgccaccgctcccccaccgccgggccccatgcagccccgcctggagcagctc
aaaactcacgtccaggtgatcaagaggtcagccaagccgagtgagaagccccggctgcgg
cagataccctcggctgaagacctggagacagatggcgggggaccgggccaggtggtagac
gatggcctggagcacagggagctgggccatgggcagcctgaggccagaggccccgctcct
ctccagcagcaccctcaggtgttgctctgggaacagcagcgactggctgggcggctcccc
cggggcagcaccggggacactgtgctgcttcctctggcccagggtgggcaccggcctctg
tcccgggcacagtcttccccagccgcacctgcctcactgtcagccccagagcctgccagc
caggcccgagtcctctccagctcagagacccctgccaggaccctgcccttcaccacaggg
ctgatctatgactcggtcatgctgaagcaccagtgctcctgcggtgacaacagcaggcac
ccggagcacgccggccgcatccagagcatctggtcccggctgcaggagcggggactccgg
agccagtgtgagtgtctccgaggccggaaggcctccctggaagagctgcagtcggtccac
tctgagcggcacgtgctcctctacggcaccaacccgctcagccgcctcaaactggacaac
gggaagctggcagggctcctggcacagcggatgtttgtgatgctgccctgtggtggggtt
ggggtggacactgacaccatctggaatgagctgcattcctccaatgcagcccgctgggcc
gctggcagtgtcactgacctcgccttcaaagtggcttctcgtgagctaaagaatggtttc
gctgtggtgcggcccccaggacaccatgcagatcattcaacagccatgggcttctgcttc
ttcaactcagtggccatcgcctgccggcagctgcagcagcagagcaaggccagcaagatc
ctcattgtagactgggacgtgcaccatggcaacggcacccagcaaaccttctaccaagac
cccagtgtgctctacatctccctgcatcgccatgacgacggcaacttcttcccggggagt
ggggctgtggatgaggtaggggctggcagcggtgagggcttcaatgtcaatgtggcctgg
gctggaggtctggacccccccatgggggatcctgagtacctggctgctttcaggattgtc
gtgatgcccatcgcccgagagttctctccagacctagtcctggtgtctgctggatttgat
gctgctgagggtcacccggccccactgggtggctaccatgtttctgccaaatgttttggg
tacatgacgcagcaactgatgaacctggcaggaggtgcagtggtgctggccttggagggt
ggccatgacctcacagccatctgtgacgcctctgaggcctgtgtggctgctcttctgggt
aacaaggtggatcccctttcagaagaaggctggaaacagaaacccaacctcaatgccatc
cgctctctggaggccgtaatccgggtgcacagtaaatactggggctgcatgcagcgcctg
gcctcctgtccagactcctgggtgcctagagtgccaggggctgacaaagaagaagtggag
gcagtgaccgcactggcatccctctctgtgggcatcctggctgaagataggccgtcggag
cagctggtggaggaggaagaacctatgaatctctaa

DBGET integrated database retrieval system