KEGG   Pongo abelii (Sumatran orangutan): 100431310Help
Entry
100431310         CDS       T01416                                 

Gene name
SETDB1
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1 isoform X1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00310  Lysine degradation
pon04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100431310 (SETDB1)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100431310 (SETDB1)
Enzymes [BR:pon01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100431310 (SETDB1)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100431310 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100431310 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD DUF4537
Motif
Other DBs
NCBI-GeneID: 100431310
NCBI-ProteinID: XP_024102253
LinkDB All DBs
Position
1
AA seq 1306 aa AA seqDB search
MCEVFGLWILEDKSMSSLPGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDE
ELEKMDCVQQRKKQLAELETWVIQKESEVAQVDQLFDDASRAVTNCESLVKDFYSKLGLQ
YRDSSSEDESSRPTEIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQK
FMDAVNKKSSSQDLHKGTLSQMSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGP
GKKYKVKFDNKGKSLLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPN
VKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMV
LLKSGQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSA
SALEKKQGQLRTRPNMGAVRSKGPVVQYTQDLTGTGTQFKPVEPPQPTAPPAPPFLPAPP
LSPQAGDSESLESQLAQSRKQVAKKSTSFRPGSVGSGHSSPTSPALSENVSGGKPGINQT
YRSPLGSTASAPAPSALPAPPAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSR
VRPMRNEQYRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYL
FETGCDFLFLEMFCLDPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQV
AYSKERIPGKGVFINTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGY
QYKRLEECLPTGVYECNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAK
GSFVCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDL
KDQEDGNSGTEDPEESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSETTSK
DSHPPDLGPPHIPVPPSIPVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSHSSFK
TNEGGEGRAGGSRMEAEKASTSGLGIKDEGDIKQAKKEDPDDRNKMSVVTESSRNYGYNP
SPVKPEGLRRPPSKTSMHQSRRLMASAQSNPDDVLTLSSSTESEGESGTSRKPTAGQTSA
TAVDSDDIQTISSGSEGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASV
DKGESAPVRKNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFP
WVAFFASKRIRAGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3921 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaagtatttggattgtggatattagaggacaaaagcatgtcttcccttcctggg
tgcattggtttggatgcagcaacagctacagtggagtctgaagagattgcagagctgcaa
caggcagtggttgaggaactgggtatctctatggaggaacttcggcatttcatcgatgag
gaactggagaagatggattgtgtacagcaacgcaagaagcagctagcagagttagagaca
tgggtaatacagaaagaatctgaggtggctcaagttgaccaactctttgatgatgcatca
agggcagtgactaattgtgagtctttggtgaaggacttctactccaagctgggactacaa
taccgggacagtagctctgaggacgaatcttcccggcctacagaaataattgagattcct
gatgaagatgatgatgtcctcagtattgattcaggtgatgctgggagcagaactccaaaa
gaccagaagctccgtgaagctatggctgccttaagaaagtcagctcaagatgttcagaag
ttcatggatgctgtcaacaagaagagcagttcccaggatctgcataaaggaaccttgagt
cagatgtctggagaactaagcaaagatggtgacctgatagtcagcatgcgaattctgggc
aagaagagaactaagacttggcataaaggcacgcttattgccatccagacagttgggcca
gggaagaaatacaaggtgaaatttgacaacaaaggaaagagtctactgtcggggaaccat
attgcctatgattaccaccctcctgctgacaagctgtatgtgggcagtcgggtggtcgcc
aaatacaaagatgggaatcaggtctggctctatgctggcattgtagctgagacaccaaac
gtcaaaaacaagctcaggtttctcattttctttgatgatggctatgcttcctatgtcaca
cagtcggaactgtatcccatttgccggccactgaaaaagacttgggaggacatagaagac
atctcctgccgtgacttcatagaggagtatgtcactgcctaccccaaccgccccatggta
ctgctcaagagtggccagcttatcaagactgagtgggaaggcacgtggtggaagtcccga
gttgaggaggtggatggcagcctagtcaggatcctcttcctggatgacaaaagatgtgag
tggatctatcgaggctctacacggctggagcccatgttcagcatgaaaacatcctcagcc
tctgcactggagaagaagcaaggacagctcaggacacgtccaaatatgggtgctgtgagg
agcaaaggccctgttgtccaatacacacaggatctgaccggtactggaacccagttcaag
ccagtggaacccccacagcctacagctccacctgccccacctttcctacctgctccacct
ctgtccccccaagcaggtgacagtgaaagcttggaaagccagcttgcccagtcacggaag
caggtagccaaaaagagcacgtcctttcgaccaggatctgtgggctctggtcattcctcc
cctacatctcctgcactcagtgaaaatgtctctggtgggaaacctgggatcaaccagaca
tatagatcacctttaggctccacagcctctgccccagcaccctcagcactcccagcccct
ccagcacccccagccttccatggcatgctggagcgggccccagcagagccctcctaccgt
gctcccatggagaagcttttctacttacctcatgtctgcagctatacctgtctgtctcga
gtcagacctatgaggaatgagcagtaccggggcaagaaccctctgctggtcccattacta
tatgacttccggcggatgacagcccggcgtcgagttaaccgcaagatgggctttcatgtt
atctataagacaccttgtggtctctgccttcggacaatgcaggaaatagaacgctacctt
ttcgagactggttgtgacttcctcttcctggagatgttctgtttggatccatatgttctt
gtggaccgaaagtttcagccctataagcctttttactatattttggacatcacttatggg
aaggaagatgttcccctatcctgtgtcaatgagattgacacaacccctccaccccaggtg
gcctacagcaaggaacgtatcccgggcaagggtgttttcattaacacaggccctgaattt
ctggttggctgtgactgcaaggatgggtgtcgggacaagtccaagtgtgcctgccatcaa
ctaactatccaggctacagcctgtaccccaggaggccaaatcaaccctaactctggctac
cagtacaagagactagaagagtgtctacccacaggggtatatgaatgtaacaaacgctgc
aaatgtgacccaaacatgtgcacaaaccggttggtgcaacatggactacaagttcggcta
cagctattcaagacacagaacaagggctggggtatccgctgcttggatgacattgccaaa
ggctcttttgtctgtatttatgcaggcaaaatcctgacagatgactttgcagacaaggag
ggtctggaaatgggtgatgagtactttgcaaatctggaccatatcgagagcgtggagaac
ttcaaagaaggatatgagagtgatgccccctgttcctctgacagcagtggtgtagacttg
aaggaccaggaagatggcaacagcggtacagaggaccctgaagagtccaatgatgatagc
tcagatgataacttctgtaaagatgaggacttcagcaccagttcagtgtggcggagctat
gctacccggaggcagacccggggccagaaagagaacggactctctgagacaacttccaag
gactcccatcccccagatcttggacccccacatattcctgttcctccctcaatccctgta
ggtggctgcaatccaccttcctccgaagagacacccaagaacaaggtggcctcatggttg
agctgcaatagtgtcagtgaaggtggttttgctgactctgatagccattcatccttcaag
actaatgaaggtggggagggccgggctgggggaagccgaatggaggctgagaaggcctcc
acctcaggactaggcatcaaggatgagggagacatcaaacaggccaagaaagaggaccct
gacgaccgaaacaagatgtcagtagttactgaaagctctcgaaattacggttacaatcct
tctcctgtgaagcctgaaggacttcgccgcccacctagtaagactagtatgcatcaaagc
cgaagactcatggcttctgctcagtctaaccctgatgatgtcctgacactgtccagcagc
acagaaagtgagggggaaagtgggaccagccgaaagcccactgctggtcagacttcggct
acagcggttgacagtgatgatatccagaccatctcctctggctctgaaggggatgacttt
gaggacaagaagaacatgactggtccaatgaagcgtcaagtggcagtaaaatcaacccga
ggctttgctcttaaatcaacccatgggattgcaattaaatcaaccaacatggcttctgtg
gacaagggggagagcgcacctgttcgtaagaacacacgccaattctacgatggcgaggaa
tcttgctacatcatcgatgccaagcttgaaggcaacctgggccgctacctcaatcacagt
tgcagccccaacctgtttgtccagaatgtcttcgtggatacccatgatcttcgcttcccc
tgggtggccttctttgccagcaaaagaatccgggctgggacagaacttacttgggactac
aactacgaggtgggcagtgtggaaggcaaggagctgctctgttgctgtggggccattgaa
tgcagaggacgtcttctttag

DBGET integrated database retrieval system